Navigation Links
Amylin Pharmaceuticals Announces Positive Results from Dose-Ranging Clinical Study of Pramlintide/Metreleptin Combination Treatment for Obesity
Date:7/9/2009

BMI 27-35 kg/m2), combination treatment with pramlintide/metreleptin (360 mcg/5 mg twice daily) resulted in an average weight loss of 12.7% (25 pounds) from enrollment, significantly more than treatment with pramlintide alone (360 mcg twice daily) who experienced an average weight loss of 8.4% (17 pounds) or metreleptin alone (5 mg twice daily) who experienced an average weight loss of 8.2% (16 pounds).

Amylin Pharmaceuticals

Amylin Pharmaceuticals is a biopharmaceutical company committed to improving lives through the discovery, development and commercialization of innovative medicines. Amylin has developed and gained approval for two first-in-class medicines for diabetes, SYMLIN(R) (pramlintide acetate) injection and BYETTA(R) (exenatide) injection. Amylin's research and development activities leverage the Company's expertise in metabolism to develop potential therapies to treat diabetes and obesity. Amylin is headquartered in San Diego, California. Further information on Amylin Pharmaceuticals is available at http://www.amylin.com.

This press release contains forward-looking statements about Amylin, which involve risks and uncertainties. The Company's actual results could differ materially from those discussed due to a number of risks and uncertainties, including that our clinical trials may not start when planned and/or confirm previous results; our preclinical studies may not be predictive; our product candidates may not receive regulatory approval; and inherent scientific, regulatory and other risks in the drug development and commercialization process. These and additional risks and uncertainties are described more fully in the Company's most recently filed SEC documents, including its Form 10-Q. Amylin undertakes no duty to update these forward-looking statements.


'/>"/>
SOURCE Amylin Pharmaceuticals, Inc.
Copyright©2009 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4 5

Related biology technology :

1. Amylin Pharmaceuticals to Present at Piper Jaffray Europe Conference
2. Amylin Pharmaceuticals to Present at Goldman Sachs Annual Global Health Care Conference
3. Amylin Announces Preliminary Tabulation of Annual Meeting Results
4. Amylin Responds to Eastbourne Letter
5. Amylin Comments on RiskMetrics Report
6. Amylin Pharmaceuticals to Present at Deutsche Bank Health Care Conference
7. Amylin Co-Founder Announces Plans to Vote for Eastbourne Slate
8. Amylin Pharmaceuticals Announces a New Sales Approach to Better Target the Diabetes Market
9. Amylin Issues Statement in Response to Carl Icahn
10. Icahn Asks Amylin to Allow Discussions With Eastbourne
11. Amylin Pharmaceuticals Provides Shareholders with Update Regarding Recent Developments
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: