Navigation Links
ATS Medical Announces CE Mark Approval for the ATS 3f Enable Bioprosthesis
Date:12/7/2009

MINNEAPOLIS, Dec. 7 /PRNewswire-FirstCall/ -- ATS Medical, Inc. (Nasdaq: ATSI), manufacturer and marketer of state-of-the-art cardiac surgery products and services today announced it has received CE Mark approval to distribute the ATS 3f Enable® Aortic Bioprosthesis in the European Union, indicating it is compliant with relevant European health, safety, and environmental protection legislation. The Enable valve is the first surgical aortic valve replacement approved for commercial use that is implanted using a sutureless technique. It is the first valve of the ATS 3f Enable platform which combines the novel 3f tubular pericardial valve design with its superior hemodynamic profiles and a self-expanding frame to hold the valve in its optimal position.

The goal of the Enable valve is to achieve a less invasive aortic valve replacement and reduce procedure times. Today, most aortic valve surgery cannot be done on a minimally invasive basis because precise suturing is difficult within the confined space of a minimally invasive procedure. The sutureless Enable valve can be folded into a small diameter to allow placement through a minimally invasive incision. Once the Enable valve is delivered to the site of the annulus, it is expanded to its preconfigured diameter and is held in place with a resistance fit.

"We have been implanting the ATS Enable valve for four years achieving excellent hemodynamic and safety results. This valve is an important step toward the goal of reducing procedure time and allowing for a more minimally invasive approach to conventional valve surgery," stated Professor Jerzy Sadowski MD, PhD, Jagiellonian University, Department of CV Surgery and Transplantology, Krakow, Poland. Professor Sadowski and his surgical team performed the first human implant of the Enable valve in January 2005.
'/>"/>

SOURCE ATS Medical, Inc.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Alberta companies delivering new products to the health & medical marketplace
2. Inverness Medical Innovations Declares Dividend on its Series B Convertible Perpetual Preferred Stock
3. Medical Research Leaders Explore Novel Strategies to Expedite the Search for Cures
4. Gamida Cell Announces Feasibility Study With Weill Cornell Medical College
5. New Jerseys Best and Brightest Minds Discuss Challenges Facing Medical Innovation, Call for Policies to Preserve U.S. Leadership in Research and Development
6. PacsDrive Announces Low Cost Medical Imaging Storage Service, Seeks to Alter Status Quo in Health Care IT
7. Aethlon Medical to Present at LD MICRO Conference on December 3, 2009
8. China Sky One Medical, Inc. Signs Distribution Agreement with MDK for the Sale of Two Diagnostic Kits in Southeast Asia
9. ISMPP Announces Publication of Good Publication Practice for Communicating Company-Sponsored Medical Research: GPP2 Guidelines Published in the BMJ
10. Exiqon Recognizes Harvard Medical School Core Facility as MicroRNA Screening Center of Excellence
11. Elsevier is Re-Launching "Embase" to be a Powerful Resource Providing Deep Insights and Answers to Biomedical Researchers
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: