Navigation Links
A*STAR IHPC and IDA to Co-Develop Innovative Cloud-Enabled Technological Solutions for Local ICT Companies to be More Competitive
Date:9/4/2013

traditional IT structure[1]. The speed, reliability and feasibility of large scale data processing could be improved by dynamically optimising and scheduling the computational processes on cloud infrastructure such as Amazon EC2, S3, or Windows Azure. Such technologies in turn could be applied to a wide spectrum of areas such as aerospace, transport, surveillance, and healthcare.
  • Brand-Centric Social Media Analysis: IHPC scientists are working on a social media analyser to help customer-facing organisations to monitor, track and analyse near-to-real time social media perceptions about their businesses and identify emerging pertinent social media trends. It also allows fine tailoring of these tools and methods for specific organisations to achieve greater accuracy of results.
    • Complex Systems Modelling: IHPC scientists have won the top prize from the Institute of Electrical and Electronics Engineers (IEEE) in 2013 for scalable complex modelling, which involves using an analyser of multiple simulated scenarios to enable companies, for example, in the transport or logistic industries, to make faster decisions (such as significantly reducing turnaround time of 9 hours to 30 minutes) so as to achieve lower costs and enhance productivity.

    "The collaboration between IHPC and IDA will promote the use of cloud-based services and technologies, and enhance the productivity and competitiveness of local businesses. We envisage the availability of such resources will lower entry barriers of capital investment, and allow quicker idea-to-market implementation. IHPC will also offer its expertise in data analysis, computational modelling and simulation to ICT companies to strengthen innovation and deepen capabilities in developing solutions," said Professor Alfred Huan, Executive Director of IHPC.

    "This collaboratio
    '/>"/>

    SOURCE Agency for Science, Technology and Research (A*STAR)
    Copyright©2012 PR Newswire.
    All rights reserved

    Page: 1 2 3 4 5

    Related biology technology :

    1. Pfizer, GSK, and Siemens Form R&D Consortium With A*STARs Institute of Chemical & Engineering Sciences
    2. Frost & Sullivan Recognizes A*STAR, Singapore with the 2012 Asia Pacific National Innovation Development Award
    3. PrimeraDx to Co-Develop Companion Diagnostics with Quest Diagnostics
    4. The Trendlines Group Announces Co-development Agreement with Endo
    5. Dr. David L. Blecker MD, MPH, F.A.C.P. Joins Inergetics Advisory Board to Co-Develop and Market Products to Penetrate Nephrology Market
    6. Cancer Patients to See More Precise Oncology Treatment via Innovative Life Sciences Coalition
    7. Chemists develop innovative nano-sensors for multiple proteins
    8. Newlight Named Most Innovative Company of the Year
    9. BIT Group to Showcase Innovative Hybrid System Design at AACC
    10. SoundConnect Launches Innovative Partner Incentive Program
    11. DuPont Tate & Lyle Bio Products Launches Innovative New Food Ingredient
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
    (Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
    (Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
    (Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
    Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
    ... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
    ... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
    ... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
    Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
    (Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
    (Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
    (Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
    Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
    ... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
    ... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
    ... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
    Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
    Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
    ... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
    ... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
    Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
    Biology Products: