Navigation Links
3D Biomatrix Announces Stipend to Present at Spring 2013 Conferences
Date:3/19/2013

Ann Arbor, MI (PRWEB) March 19, 2013

3D Biomatrix, a leader in three-dimensional (3D) cell culture products, is pleased to announce the winners of its Spring 2013 Conference Stipend. The three researchers were each awarded $500 for presenting the results they obtained from using Perfecta3D® Hanging Drop Plates at Spring 2013 conferences. The winners are:

(1) Wei-Sheng Chen, Tufts University, TD139, a galectin-1 and galectin-3- specific inhibitor, mitigates VEGF-A-induced Angiogenesis (Experimental Biology 2013, April 20-24, Boston, MA)
(2) Marylou Ingram, Huntington Medical Research Center, Tumor Histoids: Scalable Production of Living Human Mini-tumors for High Throughput Drug Screening (Cyto2013, May 19-22, San Diego, CA)
(3) Xuemei Zhong, Boston University Medical Center, Guardian Angels in the Graveyard: B1 B Cells Promote Thymic Treg Survival (Immunology 2013 AAI Annual Meeting, May 3-7, Honolulu, HI)

Additional information about the presentations, including abstracts and presentation dates, times, and locations, can be found on the 3D Biomatrix website.

Perfecta3D Hanging Drop Plates allow life science researchers to work in an environment that simulates the three dimensions of the human body more closely than existing flat, two-dimensional (2D) cell culture techniques, such as the Petri dish. With one spheroid per well, the plates facilitate the formation, culture, and testing of 3D spheroids and stem cell aggregates, including embryoid bodies, in a standard 96- or 384-well plate form
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. EAS Consulting Group, Experts in Quality Regulatory Services Related to FDA Issues, Announces Upcoming Dietary Supplement Seminars in Salt Lake City
2. Probiotic Action Announces China’s $5 Billion Dollar Investment in Probiotics
3. DuPont Tate & Lyle Bio Products Announces Novel Application for Zemea® Propanediol
4. EAG Announces New General Manager of Release-To-Production (RTP) Division
5. Neuralstem Announces 2012 Financial Results, Provides Clinical Trials Update
6. Senomyx Announces Fourth Quarter And Full Year 2012 Financial Results And Initiation Of New Direct Sales Strategy
7. Verenium Announces Preliminary Financial Results For Fiscal 2012
8. Probiotic Action Announces Probiotics Lead the Digestive Health Market
9. Annual Conference about Technology Solutions for People with Disabilities Announces Program
10. DistinctBright, Probiotic Cleaner, Announces their Probiotic Cleaner is Safe for Pets
11. Research and Markets Announces the Release of Transdermal Pain Management to 2016. Products, Markets, Forecasts and Opportunities
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... BioPlus Specialty Pharmacy ... has an expanded team of Regional Pharmaceutical Care ... prescriber offices in their regions, with specific areas ... a variety of Regional Pharmaceutical Care Liaisons specializing ... hepatitis C help prescribers understand all the new ...
(Date:12/19/2014)... ME (PRWEB) December 18, 2014 Ed ... director of the Center for Excellence in the Neurosciences ... New England, has been selected as a member of ... is the first neuroscientist from Maine to receive this ... nonprofit organization supported entirely by the Dana Foundation. ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)... Mass. , Dec. 18, 2014  Decision Resources ... dental biomaterial market will grow moderately through 2023 ... procedures and growing awareness of dental biomaterials all spur ... markets such as China and ... will bring dental procedures within reach for a larger ...
Breaking Biology Technology:BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 2UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 3Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 2Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: