Navigation Links
34 percent of Galician secondary schools exceed maximum recommended radon levels
Date:2/16/2011

but they say that corrective measures should be taken to reduce high radon levels, "which are fairly effective and cost relatively little if they are put into place during the construction of buildings".

These corrective actions range from more effective management of ventilation in buildings in the least serious cases right through to directly extracting the gas from the subsoil (before it manages to seep inside the premises) in cases where levels are higher. Radon filters in from the ground through cracks in the foundations, walls and the plumbing in bathrooms. Including architectural barriers that are impermeable to the gas are recommended in newly constructed buildings.

Llerena explains the process: "The first thing is to identify whether there is a problem. After this, detailed measurements will be taken to find out the entry points for the gas. On the basis of these data, suggestions will be made about whether simply to improve ventilation or to carry out more in-depth work, for example making the building gas-impermeable or draining radon from the subsoil before it can get into the building. Each building is a world unto itself".

The soils in Galicia have high potential for radon emission, since they overlie an area of fractured granite. Exposure to this natural radioactive element occurs, above all, as a result of inhaling it in poorly-ventilated premises, although it can also be ingested if it is present dissolved in water.


'/>"/>

Contact: SINC
info@plataformasinc.es
34-914-251-820
FECYT - Spanish Foundation for Science and Technology
Source:Eurekalert  

Page: 1 2

Related biology technology :

1. 34 percent of Galician secondary schools exceed maximum recommended radon levels
2. Codexis Grows Revenue 35 Percent in Third Quarter; Raises 2010 Outlook
3. ReVisions Fenretinide (RT-101) Reduced Incidence of Choroidal Neovascularization by More Than 50 Percent in Patients With Geographic Atrophy in a Phase 2b Trial
4. Tecnalia investigates ecological cement that cuts CO2 emissions by up to 100 percent
5. ClearTrial to Demonstrate How a Top 20 Sponsor Achieved -1 Percent Cost Variance Across Their $130M Clinical Portfolio at Major Industry Conference
6. In 2012, Stelara and Briakinumab Will Capture 22 Percent of the Biologics Share in the Moderate to Severe Psoriasis Drug Market
7. ThermoGenesis Reports 15 Percent Increase in First Quarter Revenues; Improved Bottom Line
8. Recently Approved Onglyza Is Covered by 44 Percent of Commercial Health Plans But Less Than One Percent of Medicare Plans for The Treatment of Type 2 Diabetes
9. New Assay Detects 100 Percent of Stage I, II and III Colon Cancers in Pre-Clinical Trials
10. Nearly 70 Percent of Health Professionals Support Biotechnologys Use in Food Products
11. R&D Spending by U.S. Biopharmaceutical Companies Increases 3 Percent in 2008
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
34 percent of Galician secondary schools exceed maximum recommended radon levels
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: