Navigation Links
pET GST Fusion System 42 from Novagen

ProductspET GST Fusion System 42 from Novagen
Company Novagen
Item pET GST Fusion System 42
Price $373.00
Description Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTTag fusion proteins can be purified with immobilized glutathione. Gentle elution is achieved with buffers containing reduced glutathione. Quantification of soluble GST fusions is also possible by assaying the transferase activity. In order to further enhance the utility of GST as a fusion tag, Novagen has designed two new multi-frame pET vectors, pET-41a-c(+) and pET-42a-c (+). In addition to featuring the powerful T7lac promoter, these vectors encode the GSTTag (220 aa), proteolytic sites, HisTag (6 aa) and STag (15 aa) sequences.

In contrast to other commercially available GST-fusion vectors, the Xa (IleGluGlyArg, pET-42 series) and enterokinase (AspAspAspAspLys, pET-41 series) proteolytic cleavage sites have been engineered to allow 100% complete removal of vector encoded sequences and the generation of native proteins with their authentic N-terminal residues.

The HisTag and STag sequences enable alternative protein detection and purification procedures to be performed; for example, when enhancing purity with a separate purification method, or when purifying under denaturing conditions.

1. Smith, D.B. and Johnson, K.S. (1988) Gene 67, 3140.
Info NovagenNovagen
441 Charmany Drive
Madison, WI 53719
Customer Service: 800-526-7319
Tech Support: 800-207-0144
Fax Number: 608-238-1388
Web Site: http://www.novagen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. pET GST Fusion System 42 plus Competent Cells from Novagen
2. pET GST Fusion System 41 plus Competent Cells from Novagen
3. pET GST Fusion System 41 from Novagen
4. His-Patch ThioFusion Expression System from Invitrogen
5. R.A.P.I.D. System from Idaho Technology Inc.
6. CEQ 8800 Genetic Analysis System from Beckman Coulter
7. ProteomeLab PA 800 Protein Characterization System from Beckman Coulter
8. ProteomeLab PF 2D Protein Fractionation System from Beckman Coulter
9. Mouse Dopaminergic Neuron Differentiation Kit, 2nd Generation from R&D Systems
10. CEQ 8000 Genetic Analysis System from Beckman Coulter
11. LCMS-IT-TOF Formula Predictor System from Shimadzu
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: