Navigation Links
Whole Genome Sequencing from Agencourt Bioscience

ProductsWhole Genome Sequencing from Agencourt Bioscience
Company Agencourt Bioscience
Item Whole Genome Sequencing
Price 
Description Agencourt offers a high quality whole genome sequencing service. Our efforts to increase quality while reducing costs allow even the smallest of laboratories to undertake whole genome sequencing endeavors. The key features which set our whole genome sequencing service apart are our unique library construction strategies, proprietary assembly software, rapid project turnaround and our proven experience with large scale genome projects including whole genome sequencing as an NHGRI-funded large sequencing center.
Info Agencourt BioscienceAgencourt Bioscience
500 Cummings Center, Suite 2450
Beverly, MA 01915
U.S. and Canada 800-361-7780
Outside U.S. and Canada 978-867-2603

Fax Number: 978-867-2601
Web Site: http://www.agencourt.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. S. pombe Whole Genome ChIP-on-chip from Agilent Technologies
2. S. cerevisiae yeast Whole Genome from Agilent Technologies
3. S. cerevisiae yeast Whole Genome from Agilent Technologies
4. GenomePlex Single Cell Whole Genome Amplification Kit from Sigma-Aldrich
5. GenomePlex Whole Genome Amplification (WGA) kit from Sigma-Aldrich
6. Genome-pULSe ULS arrayCGH Whole Genome Amplification and Labeling Kit (with REPLI-g and Cy3-ULS / Cy5-ULS from KREATECH Biotechnology
7. Whole-Genome Shotgun Sequencing from Seqwright
8. Rabbit Anti-Ferret Whole Serum Polyclonal Antibody, Unconjugated from Bethyl Laboratories
9. Rat Whole Blood Non-Sterile Alsevers from Pel-Freez Biologicals
10. HP GenomeWide siRNA from QIAGEN
11. Genome Sequencer 20 System from Roche Applied Science
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: