Navigation Links
Varian NMR System from Varian, Inc.

ProductsVarian NMR System from Varian, Inc.
Company Varian, Inc.
Item Varian NMR System
Price Inquire
Description Engineered with new technology incorporating the sophisticated DirectDrive architecture and designed for unsurpassed flexibility, the new Varian NMR System is undeniably the most advanced spectrometer available today.

The Varian NMR System features parallel controllers for each transmitter and receiver channel, providing pulse sequence programming power with functionality and user friendliness. Supported by the highly acclaimed VnmrJ software for data acquisition and processing, the Varian NMR System is the optimal spectrometer for methods development and everyday applications.

Info Varian, Inc.Varian, Inc.
2700 Mitchell Drive
Walnut Creek, CA 94598

Call Varian, Inc. to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-377-0104
Customer Service: 1-800-926-3000
Web Site: http://www.varianinc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Excalibur 3100 from Varian, Inc.
2. 1200 LC/MS from Varian, Inc.
3. Varian 820-MS from Varian, Inc.
4. Varian 2200 Ion Trap GC/MS from Varian, Inc.
5. 500-MS LC Ion Trap from Varian, Inc.
6. Varian 810-MS from Varian, Inc.
7. Varian CP-4900 Micro-GC from Varian, Inc.
8. Cetac U-6000AT+ Ultrasonic Nebulizer with desolvation unit 220V, 50 Hz from Varian, Inc.
9. Cetac U-5000AT+, Ultrasonic Nebulizer 110V, 60 Hz from Varian, Inc.
10. Cetac U-6000AT+ Ultrasonic Nebulizer with desolvation unit 110V, 60Hz from Varian, Inc.
11. Varian Cary 6000i Spectrophotometer from Varian, Inc.
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: