Navigation Links
Rabbit Anti-Porcine LACTATE DEHYDROGENASE H4 Polyclonal Antibody, Unconjugated from AbD Serotec

ProductsRabbit Anti-Porcine LACTATE DEHYDROGENASE H4 Polyclonal Antibody, Unconjugated from AbD Serotec
Company AbD Serotec
Item Rabbit Anti-Porcine LACTATE DEHYDROGENASE H4 Polyclonal Antibody, Unconjugated
Price $248.00
Description ANTI PIG LDH H4
Info AbD SerotecAbD Serotec

UK & Ireland
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

North & South America
MorphoSys US Inc
3200 Atlantic Avenue, Suite 125
Raleigh, NC 27604, USA
Toll Free: 1-800-265-7376
Tel: 919-878-7978
Fax: 919-878-3751
E-mail: sales.us@ab-direct.com

Scandinavia & Baltic States
MorphoSys UK Ltd (Scandinavia)
Postboks 4079
N-2306 HAMAR, Norway
Tel: +44 (0)1865 852 728
Fax: +44 (0)1865 852 739
E-mail: sales.no@ab-direct.com

France & Belgium
MorphoSys UK Ltd (France)
15 rue des Pas Perdus
BP 38338
95804 Cergy Saint-Christophe
France
Tel: + 33 1 34 25 83 34
Fax: + 33 1 34 25 44 00
E-mail: sales.fr@ab-direct.com

Germany, Netherlands, Austria & Switzerland
MorphoSys AbD GmbH
Immermannstr. 13
D-40210 Dsseldorf
Germany
Tel (General): +49 (0)211 93 503 10
Tel (Technical): +49 (0)211 93 503 11
Fax: +49 (0)211 93 503 12
E-mail: sales.de@ab-direct.com

Worldwide
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

Customer Service: 1-800-265-7376
Fax Number: 1-919-878-3751
Web Site: www.ab-direct.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
6. Human CALCA EIA (Enzyme immunoassay) Kit, Host: Rabbit ; Extraction-free from BACHEM
7. MaxArray Tissue Array (Animal - Rabbit) from Invitrogen
8. Rabbit Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
9. Rabbit Anti-Shigella Polyclonal Antibody, Unconjugated from GeneTex
10. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
11. Dermal Fibroblasts, Rabbit from CHEMICON
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: