Navigation Links
Pathway Studio Enterprise from Ariadne Genomics

ProductsPathway Studio Enterprise from Ariadne Genomics
Company Ariadne Genomics
Item Pathway Studio Enterprise
Price 
Description Pathway Studio Enterprise is integrated informatics solution for the research of cellular regulatory mechanisms and drug response modeling. This web-based software comes with ResNet, the worlds largest knowledge base of biological networks, and can be equipped with MedScan module capable of extracting pathway-related information from scientific literature.
  • Identify relationships among genes, cell processes, diseases and treatments
  • Discover cellular responses to drug target candidates
  • Facilitate biomarker discovery
  • Predict side effects in toxicology studies
  • Interpret gene expression and proteomics data
  • Track research data across multiple pathways

Pathway Studio Enterprise allows scientists to build and visualize pathway models, reconstruct biological mechanisms from microarray and other experimental data, predict drug effects and discover bio-markers in a complete, secure data management environment. It can easily accommodate proprietary data, allowing exporting, importing and curation of information in the database.

Info Ariadne GenomicsAriadne Genomics
9700 Great Seneca Hwy., Rockville, MD 20850

Call Ariadne Genomics to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-240-238-0397
Customer Service: (240) 453-6296
Fax Number: (240) 453-6208
Web Site: http://www.ariadnegenomics.com/?cmp=Biocompare
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. BD Pathway 435 confocal bioimager from BD Biosciences - Bioimaging
2. BD Pathway 415 bioimager from BD Biosciences - Bioimaging
3. BD Pathway Bioimager from BD Biosciences - Bioimaging
4. Apoptosis Pathway SpliceArrays from ExonHit Therapeutics Inc.
5. Mouse cAMP / Ca2+ Signaling PathwayFinder, PCR Array for expression profiling from SuperArray Bioscience
6. Mouse NFkB Signaling Pathway, PCR Array for expression profiling from SuperArray Bioscience
7. Rat NFkB Signaling Pathway, PCR Array for expression profiling from SuperArray Bioscience
8. Rat Signal Transduction PathwayFinder, PCR Array for expression profiling from SuperArray Bioscience
9. Acuity Enterprise Microarray Informatics Software from Molecular Devices
10. Flammable Chemical Cabinets, Justrite Model 25732 from South Coast Enterprises
11. Flammable Chemical Cabinets, Justrite Model RL25762Y from South Coast Enterprises
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4