Navigation Links
PG 3000 Photographic Digital Printer from FUJIFILM Life Science

ProductsPG 3000 Photographic Digital Printer from FUJIFILM Life Science
Company FUJIFILM Life Science
Item PG 3000 Photographic Digital Printer
Price 
Description Fujifilm Pictro-Color Process for sharp, clear reproduction comparable to silver-halide photography. Photorealistic 400 dpi quality. A4 and A5 output.
Info FUJIFILM  Life ScienceFUJIFILM Life Science
419 West Avenue
Stamford, CT 06092
Customer Service: 866-902-3854
Web Site: http://www.fujifilmlifescienceusa.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. DMWB3-223ASC Digital Compound DIN from Motic Instruments, Inc.
2. DMWB1-223ASC Digital Compoud DIN from Motic Instruments, Inc.
3. Digital Clamp One from myNeuroLab.com
4. X-Valve Digital Solenoid Valve from Parker Hannifin Corporation
5. KODAK Image Station 4000MM Digital Imaging System from Molecular Imaging Systems, Carestream Health, Inc. (formerly Kodak Molecular Imaging Systems)
6. Digital Clamp One Electrophysiology Feedback Unit from myNeuroLab.com
7. DMW-143 FBGG Digital Stereo Zoom from Motic Instruments, Inc.
8. GenoMx VISION Automated Digital Image Analysis System from BioGenex
9. iVISION Automated Digital Image Analysis System from BioGenex
10. DMBA200 Digital Infinity Compound from Motic Instruments, Inc.
11. DMBA300 Digital Infinity Compound from Motic Instruments, Inc.
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... CLEVELAND , June 27, 2016  Global ... average 4.6 percent through 2020 to $7.2 billion.  ... (food and beverages, cleaning products, biofuel production, animal ... and biotechnology, diagnostics, and biocatalysts). Food and beverages ... gains driven by increasing consumption of products containing ...
(Date:6/27/2016)... ... 27, 2016 , ... Parallel 6 , the leading software as a ... Reach Virtual Patient Encounter CONSULT module which enables both audio and video telemedicine ... team. , Using the CONSULT module, patients and physicians can schedule a face to ...
(Date:6/27/2016)... 27, 2016   Ginkgo Bioworks , a leading ... was today awarded as one of the World ... world,s most innovative companies. Ginkgo Bioworks is engineering ... real world in the nutrition, health and consumer ... with customers including Fortune 500 companies to design ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita ... miRNAs in people with peritoneal or pleural mesothelioma. Their findings are the subject of ... now. , Diagnostic biomarkers are signposts in the blood, lung fluid or tissue ...
Breaking Biology Technology: