Navigation Links
PAP Pen from ScyTek Laboratories

ProductsPAP Pen from ScyTek Laboratories
Company ScyTek Laboratories
Item PAP Pen
Price $65.00
Description This marking pen has been designed to provide a thin film-like barrier when a circle is drawn around the specimen on a slide. This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed.
Info ScyTek LaboratoriesScyTek Laboratories
205 South 600 West
Logan, UT 84321
Customer Service: (800) 729-8350
Fax Number: (435) 755-0015
Web Site: http://www.scytek.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Hollandes Fixative from ScyTek Laboratories
2. Hollandes Fixative from ScyTek Laboratories
3. Alk-Phos Stabilizing Diluent from ScyTek Laboratories
4. Alk-Phos Stabilizing Diluent from ScyTek Laboratories
5. Michels Transport Wash Buffer from ScyTek Laboratories
6. HRP Stabilizing Diluent (Phosphate Buffered) without BSA from ScyTek Laboratories
7. HRP Stabilizing Diluent (MOPS Buffered) from ScyTek Laboratories
8. HRP Stabilizing Diluent (Phosphate Buffered) without BSA from ScyTek Laboratories
9. HRP Stabilizing Diluent (Phosphate Buffered) from ScyTek Laboratories
10. HRP Stabilizing Diluent (Phosphate Buffered) from ScyTek Laboratories
11. Coating Stabilizer from ScyTek Laboratories
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: