Navigation Links
NOVOstar Microplate Reader from BMG LABTECH

ProductsNOVOstar Microplate Reader from BMG LABTECH
Company BMG LABTECH
Item NOVOstar Microplate Reader
Price 
Description The NOVOstar is an exciting product for cell-based kinetic assays and research development. Previously, cell-based assays required the use of expensive HTS equipment, which lead to limited accessibility for scientists in the assay development stage. The NOVOstar offers the right equipment necessary for cell-based assays as well as any other assay suitable for the microplate format.

The NOVOstar has a dual microplate carrier that allows the user to designate a reagent and measurement microplate. Furthermore, a transfer pipet is incorporated into the design for plate-to-plate transfers along with access to three reagent stations providing you with flexibility in assay design. In addition, the unit has up to two injectors that offer the same variable delivery volume and injection speed as other BMG LABTECH OPTIMA instruments. Incubation, shaking, user-defined kinetic sampling rates, and bottom reading are all standard equipment on the NOVOstar.

Wide Range of Applications
The NOVOstar can be used for all fluorescence-based applications that can currently be read by our POLARstar OPTIMA microplate reader. Due to its integrated programmable pipettor system, the NOVOstar is especially well-suited to screen large numbers of compounds in kinetic cell-based assays or to create a dose response curve by measuring a wide range of analyte concentrations. Applications that the NOVOstar is targeted for include:

  • Ca2+ uptake
  • membrane potential studies
  • intracellular pH
  • measurement of intracellular ionic changes
  • fluorescent reporter gene assays
  • traditional fluorescence assays involving up to eight excitation and emission pairs.
Exceptional Technologies
The NOVOstar has numerous features that cannot be found on other microplate readers including:
  • Integrated Programmable Pipettor System: The system can be used for plate to plate transfer, aspirating, dispensing, or mixing fluids within a microplate well.
  • Dual Microplate Carrier: Accommodates one reagent plate and one measurement plate, allowing you to rapidly screen 96 or 384 different analytes in one test.
  • Additional Reagent Stations and Reagent Injectors: The pipettor system has access to 3 additional reagent stations (e.g. standard agonist/antagonists, ionophore, washing, etc.) and you can use any of the two injectors for dispensing these and other standard reagents.
  • Fast Kinetics: The NOVOstar is one of the few instruments that can measure kinetic events with a resolution of 20 ms, allowing for calcium uptake assays to be performed with great precision. Furthermore, the control software allows the user to define variable sampling rates throughout the test run so that data evaluation can be simplified.
  • Multi-wavelength Detection: NOVOstar uses a xenon flash lamp that allows you to measure up to eight excitation/emission pairs in each well. This allows you to read dual excitation fluorophores like fura-2 with speed and convienence.
  • Precise Temperature Control: The NOVOstar incorporates BMG LABTECHs proprietary heating plates situated above and below the entire plate movement area proving for uniform incubation up to 45C.
  • Real-time Data Observation: Assay progress can be observed with the real-time graphics feature that shows the fluorescence data either as a numerical value, color gradient, or X-Y plot.
Info BMG LABTECHBMG LABTECH
2415 Presidential Drive
Building 204, Suite 118
Durham, NC 27703


Call BMG LABTECH to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-919-323-8911
Customer Service: 919-806-1735
Fax Number: 919-806-8526
Web Site: http://www.bmglabtech.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Bio-Stack Twister II Microplate Handler from BioTek Instruments
2. ELx50 Microplate Strip Washer from BioTek Instruments
3. Bio-Stack Microplate Stacker from BioTek Instruments
4. Precision XS Microplate Sample Processor from BioTek Instruments
5. Synergy HT Multi-Detection Microplate Reader from BioTek Instruments
6. FLUOstar OPTIMA Multifunction Microplate Reader from BMG LABTECH
7. LUMIstar OPTIMA Microplate Reader from BMG LABTECH
8. Corning 96 Well Eia/Ria Microplate,Flat Bottom,Med Binding,Non-Sterile,W/O Lid from Sigma-Aldrich
9. Model 1575 Immunowash Microplate Washer from Bio-Rad
10. BD Falcon 1536-well Black/Clear Microplates from BD Biosciences - Discovery Labware
11. BD Falcon 1536-well Black Microplates from BD Biosciences - Discovery Labware
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products:
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2