Navigation Links
NO-WEIGH DTT, 7.7mg X 48 from Pierce Biotechnology, Inc.

ProductsNO-WEIGH DTT, 7.7mg X 48 from Pierce Biotechnology, Inc.
Company Pierce Biotechnology, Inc.
Item NO-WEIGH DTT, 7.7mg X 48
Price 
Description No-Weigh Dithiothreitol (DTT)
7.7 mg DTT/Tube x 48 tubes
Info Pierce Biotechnology, Inc.Pierce Biotechnology, Inc.
Pierce Biotechnology, Inc.
3747 N. Meridian Rd.
P.O. Box 117
Rockford, IL 61105
Customer Service: 815-968-0747
Fax Number: 815-968-8148
Web Site: http://www.piercenet.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Modern Protein Chemistry: Practical Aspects from Pierce Biotechnology, Inc.
2. Protein-Protein Interactions, from Pierce Biotechnology, Inc.
3. Imject Freunds Complete Adjuvant (FCA) from Pierce Biotechnology, Inc.
4. Imject Freunds Incomplete Adjuvant (FIA) from Pierce Biotechnology, Inc.
5. Extracti-Gel D Detergent Removing Gel AffinityPak Columns from Pierce Biotechnology, Inc.
6. GUIDE TO PROTEIN PURIFICA from Pierce Biotechnology, Inc.
7. PROTEIN PROTOCOLS Book from Pierce Biotechnology, Inc.
8. Product Information Request - SuperSignal West Pico COMPLETE Biotinylated Protein Detection Kit from Pierce Biotechnology, Inc.
9. UltraLink Immobilized NeutrAvidin from Pierce Biotechnology, Inc.
10. DISCOVERLIGHT RABBIT ARRA from Pierce Biotechnology, Inc.
11. PATH Protein Microarray Kit from Pierce Biotechnology, Inc.
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: