Navigation Links
MultiDoc-It Imaging System from UVP

ProductsMultiDoc-It Imaging System from UVP
Company UVP
Item MultiDoc-It Imaging System
Price 
Description The sturdy metal system is designed for multiple user laboratories for capturing gels, plates and membrane images for TLC applications. The MultiDoc-It is available without a transilluminator.
  • The enclosure provides a darkroom environment and protects the Doc-It Digital Color Camera
  • Use image capture and enhancement
  • The darkroom features built-in overhead white light
  • Optional UV lamps, and Visi-Blue filter changer, can be mounted in the darkroom for overhead UV illumination
  • Safety interlock turns UV off when the door is open
  • 4.1 mega pixel digital color camera for capturing gels, plates and membranes
  • The Doc-It camera, producing high picture quality images with low light capability, can be used in other laboratory applications
  • The Doc-It digital color camera connects to your existing computer Accessories:
  • Thermal Printer
  • Doc-It1D Analysis Software
  • The Doc-It acquisition software, included with the systems, allows capture of quality, high resolution images. Doc-It offers many features for enhancing image output:
  • Measurement tool for determining Rf values
  • Multiple image resolution settings
  • Color and monochrome
  • Over and under image saturation warnings
  • Preset zoom with sample sizes
  • Automatic and manual focus
  • Automatic exposure and lens modes
  • Templates for multiple users and experiments
  • Basic and advanced capture modes
  • Multiple file format compatibility
Darkroom Dimensions: 14W x 10D x 19H in.
Info UVPUVP
UVP, Inc.
2066 W. 11th Street
Upland, CA 91786
USA

Call UVP to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-290-5789
Customer Service:
US: (800)452-6788
UK / Europe: +44(0)1223-420022
Fax Number: (909)946-3597
Web Site: http://www.uvp.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Analog thermal printer, Sony (230V) for DigiDoc-It, MultiDoc-It and ChromaDoc-It Imaging Systems from UVP
2. Imaging Mass Spectrometry for Small Molecule Localization from Protein Discovery, Inc.
3. MetaVue from Universal Imaging Corporation (a subsidiary of Molecular Devices)
4. ProXPRESS 2D Proteomic Imaging System, Professional Package from PerkinElmer
5. GenePix Pro from Universal Imaging Corporation (a subsidiary of Molecular Devices)
6. KODAK Molecular Imaging Software Regulator Edition from Molecular Imaging Systems, Carestream Health, Inc. (formerly Kodak Molecular Imaging Systems)
7. ProXPRESS™ 2D Proteomic Imaging System, Basic Package from PerkinElmer
8. KODAK Image Station 4000MM Digital Imaging System from Molecular Imaging Systems, Carestream Health, Inc. (formerly Kodak Molecular Imaging Systems)
9. Odyssey Infrared Imaging System from LI-COR Biosciences
10. MetaMorph from Universal Imaging Corporation (a subsidiary of Molecular Devices)
11. Spotlight 400N FT-NIR Imaging System from PerkinElmer
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4