Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... - 5 units/µL ,• High specific activity ... Leaves an 'A' overhang ,• Processes ... exhibits very high activity in primer extension ... the quality of the enzyme, each lot ...
Recombinant DNA polymerase from Thermus aquaticus expressed in E. coli; 5 units/L; 1 tube of 1, 000 units enzyme/tube w/Buffer II and MgCl2...
... Enzyme concentration - 5 units/µL ,• High ... yields ,• Leaves an 'A' overhang ,• ... which exhibits very high activity in primer ... ensure the quality of the enzyme, each ...
Recombinant DNA polymerase from Thermus aquaticus expressed in E. coli; 5 units/uL; 25 tubes of 1, 000 units enzyme/tube w/ Buffer I...
Biology Products:
(Date:5/28/2020)... ... May 27, 2020 , ... ... Workforce Advisor™ , a solution that uniquely combines lab testing insights and hc1’s ... systematically support the ongoing health and safety of employees returning to the workplace. ...
(Date:5/26/2020)... ... May 26, 2020 , ... ... announced that Gritstone Oncology, Inc., a clinical-stage biotechnology company developing cancer immunotherapies, ... TCR-based therapeutics, has implemented Genedata Biologics ® within their R&D organization. ...
(Date:5/21/2020)... ... May 19, 2020 , ... ... today introduced BioMed to their award-winning computerized maintenance management system (CMMS), TheWorxHub™. ... and systems around biomedical engineering to better allocate staff time, automate assignments, ...
Breaking Biology News(10 mins):
(Date:6/11/2020)... ... June 09, 2020 , ... PathSensors Inc., a Baltimore biotechnology ... Research (SBIR) program funded by the National Institute of Food and Agriculture (NIFA) ... The project’s goal was to engineer and develop a field-deployable instrument for portable ...
(Date:5/30/2020)... ... May 29, 2020 , ... Medrio, ... and animal health markets, has enabled Cytovale, Inc., a medical technology company dedicated ... learning, to achieve their first patient in (FPI) in just seven days. The ...
(Date:5/21/2020)... ... May 21, 2020 , ... ... will cause long-term harm , Contrary to conventional wisdom that says the coronavirus ... finds many companies will emerge from the pandemic commercially weaker, dealing with delays ...
(Date:5/15/2020)... ... May 14, 2020 , ... Children with defective heart valves ... before becoming adults. The reason: there are no heart valve prosthetics designed to ... Department of Defense has awarded Draper, Boston Children’s Hospital and Seattle Children’s Research ...
Breaking Biology Technology: