Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
For cleavage of 6xHis tags from proteins containing a Factor Xa Protease recognition site Efficient 6xHis tag cleavage (greater than 90%), ...
... for interferons are cytopathic effect inhibition assays, also ... types include; tissue culture supernatents; serum from PK ... one unit is defined as the quantity of ... effect of viral infection by 50%. ...
... The BioPrime Plus Array CGH Genomic ... that enable reproducible labeling of genomic DNA ... Available in both indirect and direct labeling ... Labeling Systems provide a flexible solution to ...
... are cytopathic effect inhibition assays, also known as ... tissue culture supernatents; serum from PK studies and ... is defined as the quantity of interferon required ... viral infection by 50%. All standards ...
Biology Products:
(Date:4/6/2017)... LONDON , April 6, 2017 ... Control, RFID, ANPR, Document Readers, by End-Use (Transportation & ... Energy Facility, Oil, Gas & Fossil Generation Facility, Nuclear ... Healthcare, Educational, Other) Are you looking for ... Authentication sector? ...
(Date:4/4/2017)...   EyeLock LLC , a leader of iris-based ... Patent and Trademark Office (USPTO) has issued U.S. Patent ... an iris image with a face image acquired in ... 45 th issued patent. "The ... the multi-modal biometric capabilities that have recently come to ...
(Date:3/30/2017)... , March 30, 2017 Trends, opportunities and ... and behavioral), by technology (fingerprint, AFIS, iris recognition, facial ... and others), by end use industry (government and law ... financial and banking, and others), and by region ( ... , Asia Pacific , and the ...
Breaking Biology News(10 mins):
(Date:4/21/2017)... ... April 21, 2017 , ... ... were the focus of researchers, engineers, product developers, and industry suppliers gathered last ... Sponsored by SPIE, the international society for optics and photonics , the ...
(Date:4/20/2017)... ... April 20, 2017 , ... Assured Enterprises, Inc. ... offer a full spectrum of digital security goods and services. The strategic partners ... the ground-breaking proactive cybersecurity services and products through Assured Enterprises. The two companies ...
(Date:4/20/2017)... QC , April 20, 2017 /PRNewswire/ - Prometic Life Sciences ... presented new results at the International Liver Congress ("ILC") 2017 ... ("EASL") in Amsterdam on the positive ... a mouse model of obesity and metabolic syndrome. ... According to Dr. Lyne Gagnon, Vice-President ...
(Date:4/20/2017)... HACKENSACK, N.J. and PETACH TIKVAH, Israel ... (NASDAQ: BCLI), a leading developer of adult stem cell technologies ... Chief Executive Officer, will present at the Alliance for Regenerative ... Investor Day on Thursday, April 27, 2017 at 09:40 EDT ... Dr. Ralph Kern , MD, MHSc, Chief Medical Officer ...
Breaking Biology Technology: