Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Recombinant Mouse LIGHT/TNFSF14...
TAR DNA binding protein...
D-biotin *50 mM aqueous solution* Secondary Detection Biotin–Avidin Detection Reagents Other...
6-(2,4-dinitrophenyl)aminohexanoic acid, succinimidyl ester (DNP-X, SE)...
Biology Products:
(Date:7/23/2014)... grip is affecting more than the color of people,s lawns. ... heat-loving amoeba commonly found in warm freshwater bodies, such as ... warmer than usual this year. , A 9-year-old Kansas girl ... swimming in several area lakes. The amoeba enters the body ... brain. Nose plugs can lower the odds of this rare ...
(Date:7/23/2014)... commonly found in dead bodies and is used in ... to as the post mortem interval. A report of ... Tamil Nadu is provided for the first time based ... DNA barcoding. This study, significant in forensic investigations was ... . , Chrysomya megacephala is commonly found ...
(Date:7/23/2014)... around the world by 2050, according to one of ... Change (IPCC), may be advantageous to the physiology and ... of forage plants such as Stylosanthes capitata Vogel ... countries such as Brazil., The conclusion is from a ... Biology at the Ribeiro Preto Faculty of Philosophy, Sciences ...
Breaking Biology News(10 mins):Diseases of another kind 2Dead body feeding larvae useful in forensic investigations 2An increase in temperature by 2050 may be advantageous to the growth of forage plants 2An increase in temperature by 2050 may be advantageous to the growth of forage plants 3An increase in temperature by 2050 may be advantageous to the growth of forage plants 4
... Davis researchers in nanotechnology, chemistry and biology now have access ... in the world. The new Spectral Imaging Facility, opened this ... a laser scanning confocal microscope, the first commercial machine of ... Asylum Research of Santa Barbara and the confocal microscope system ...
... gained new insights into how neurons control growth ... that enable them to connect with their neighbors. ... which neurons form the signaling networks that constitute ... neuronal growth will help researchers better understand brain ...
... preliminary results from a study in Botswana, Harvard School ... HIV-1 subtype C in resource-poor settings, who receive antiretroviral ... the developed world. A fully supported health care delivery ... data published in November 2005 issue of the Journal ...
Cached Biology News:How the neuron sprouts its branches 2How the neuron sprouts its branches 3Largest computational biology simulation mimics life’s most essential nanomachine 2
(Date:7/23/2014)... July 23, 2014  Having the right people at ... to accelerating business growth and achieving clinical and operational ... (AHA) Leadership Summit, July 20-22, 2014, in ... hospital executives and healthcare experts discussing how partnerships have ... , President & Chief Executive Officer of Cape Regional ...
(Date:7/23/2014)... , July 23, 2014 /PRNewswire/ - BioAmber Inc. ... company producing sustainable chemicals, today announced that the underwriters ... their option to purchase an additional 420,000 shares ... of $12.00 per share, less underwriting discounts and ... public offering of 2,800,000 shares of common stock, ...
(Date:7/23/2014)... KONG , July 23, 2014 China Cord Blood ... China,s leading provider of cord blood collection, laboratory ... Cordlife Group Limited ("Cordlife"), a multi-product healthcare company catering to the ... joined forces in assisting patients across the PRC, Singapore ... , India , the Philippines ...
(Date:7/23/2014)... July 23, 2014 Astra ... and comprehensive consultancy and pharma training services, and ... Safety (ACRES) , a non-profit integrating the expertise ... and maintain a global system for clinical trials, ... to improve the expertise of industry professionals through ...
Breaking Biology Technology:MSC and Cape Regional Medical Center Partner to Improve Cost, Quality and Outcomes 2BioAmber announces exercise in full of underwriters' option in connection with previously priced follow-on offering 2BioAmber announces exercise in full of underwriters' option in connection with previously priced follow-on offering 3China Cord Blood Corporation and Cordlife Group Limited Announce Collaboration to Aid Asia-based Patients with Cord Blood Stem Cell Therapy 2China Cord Blood Corporation and Cordlife Group Limited Announce Collaboration to Aid Asia-based Patients with Cord Blood Stem Cell Therapy 3China Cord Blood Corporation and Cordlife Group Limited Announce Collaboration to Aid Asia-based Patients with Cord Blood Stem Cell Therapy 4Astra Nova and ACRES Partner on Quality and Access of Training for Research Professionals 2Astra Nova and ACRES Partner on Quality and Access of Training for Research Professionals 3