Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... The CHEMICON MDR1 Shift Assay provides a ... that occur upon transport of MDR1 substrates. Thus, ... extent to which small molecules act as transport ... increased in the presence of MDR1 substrates, the ...
... is a simple high performance method for ... detergents without significant dilution of protein solution. ... the Detergent-OUT Spin column and collect detergent ... is suitable for removing detergents from a ...
... The wide and long ... of Polaroid gel documentation systems. ... holds the camera in place ... that allows photography on the ...
... are derived from Paraffin embedded tissue blocks, ... procedures to ensure the highest quality. Tissues ... one block, sectioned at a thickness of ... Sections are large (3-5 mm in diameter) ...
Biology Products:
(Date:10/15/2014)... Lithuania , Oct. 15, 2014   ... technologies, today announced the availability of the ... VeriLook Surveillance 3.0 provides real-time biometric face identification ... high-resolution digital surveillance cameras. The new version not ... and differentiates people from objects while they are ...
(Date:10/14/2014)... (Oct. 14, 2014)—It,s been millions of years since ... team led by Ohio University scientists is breathing life ... airflow through dinosaur snouts. The research has important implications ... breathe but to enhance the sense of smell and ... animals," said Ohio University doctoral student Jason Bourke, lead ...
(Date:10/14/2014)... Sinai-led research team has discovered a new kind of stem ... cell that lines liver blood vessels, according to a study ... The existence of such a cell type contradicts current theory ... and may hold clues to origins of, and future treatment ... a single cell into a complex being made up of ...
Breaking Biology News(10 mins):VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 2VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 3Dinosaur breathing study shows that noses enhanced smelling and cooled brain 2Dinosaur breathing study shows that noses enhanced smelling and cooled brain 3Stem cell discovery challenges dogma on how fetus develops; holds insights for liver cancer and reg 2Stem cell discovery challenges dogma on how fetus develops; holds insights for liver cancer and reg 3
... Indiana University scientists have solved a perplexing mystery ... in the process shedding light on a possible route ... teenagers. The disease occurs when a genetic mutation ... glycogen. Glycogen is a chain-like molecule the body uses ...
... a flying reptile that died 89 million years ago may ... creature known as Pteranodon . Previously, Pteranodon ... Wyoming in the Niobrara and Pierre geological formations. This likely ... found in Texas, according to paleontologist Timothy S. Myers at ...
... a new way to generate human motor nerve cells in a ... team from the Universities of Edinburgh, Cambridge and Cardiff has created ... from the brain and spine to other parts of the body ... is the first time that researchers have been able to generate ...
Cached Biology News:Discovery of source of glycogen 'manufacturing' errors sheds light on fatal disease 2Rare 89 million-year-old flying reptile fossil from Texas may be world's oldest Pteranodon 2Rare 89 million-year-old flying reptile fossil from Texas may be world's oldest Pteranodon 3Rare 89 million-year-old flying reptile fossil from Texas may be world's oldest Pteranodon 4Stem cell study could aid motor neurone disease research 2
(Date:10/18/2014)... The Asia-Pacific Bio-based Advanced Phase Change Materials ... phase change material market in Asia-Pacific with analysis ... TOC of the Asia-Pacific Bio-based Advanced Phase Change ... the in-depth analysis provided. This also provides a ... advanced phase change material market, and is supported ...
(Date:10/18/2014)... October 18, 2014 The Asia-Pacific Liquid ... segments the concerned market in Asia-Pacific with analysis and ... million in 2013, and is expected to reach $380.0 ... 2013 to 2018. , Browse through the TOC of ... idea of the in-depth analysis provided. This also provides ...
(Date:10/18/2014)... 2014 The report " Cloud ... Text; Web; Speech; Machine; Video; Predictive Analytics: Global ... Forecasts & Analysis (2013 - 2018) ", defines ... various sub segments with an in-depth analysis and ... the factors driving this market, various restraints, and ...
(Date:10/17/2014)... and HILDEN, Germany , October ... , Translational research in cancer and other ... at the American Society of Human Genetics annual ... samples linked to Ingenuity ®  Knowledge Base greatly ... analysis  Ingenuity ®  Variant Analysis™ adds ...
Breaking Biology Technology:The Asia-Pacific Bio-based Advanced Phase Change Materials Market is estimated to grow to $39.8 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bio-based Advanced Phase Change Materials Market is estimated to grow to $39.8 million by 2018 - New Report by MicroMarket Monitor 3The Asia-Pacific Bio-based Advanced Phase Change Materials Market is estimated to grow to $39.8 million by 2018 - New Report by MicroMarket Monitor 4The Asia-Pacific Liquid Crystal on Silicon (LCoS) display market is expected to reach $380.0 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Liquid Crystal on Silicon (LCoS) display market is expected to reach $380.0 million by 2018 - New Report by MicroMarket Monitor 3Cloud Analytics Market (by Cloud Business Intelligence & Predictive Analytics) Expected to Cross $16.52 Billion by 2018 - New Report by MarketsandMarkets 2Cloud Analytics Market (by Cloud Business Intelligence & Predictive Analytics) Expected to Cross $16.52 Billion by 2018 - New Report by MarketsandMarkets 3Cloud Analytics Market (by Cloud Business Intelligence & Predictive Analytics) Expected to Cross $16.52 Billion by 2018 - New Report by MarketsandMarkets 4Cloud Analytics Market (by Cloud Business Intelligence & Predictive Analytics) Expected to Cross $16.52 Billion by 2018 - New Report by MarketsandMarkets 5QIAGEN Demonstrates Expanded Bioinformatics Workflows at ASHG; Strong Market Adoption as Researchers Analyze Genomic Data on More Than a Quarter-Million Samples in Secure Private Cloud 2QIAGEN Demonstrates Expanded Bioinformatics Workflows at ASHG; Strong Market Adoption as Researchers Analyze Genomic Data on More Than a Quarter-Million Samples in Secure Private Cloud 3QIAGEN Demonstrates Expanded Bioinformatics Workflows at ASHG; Strong Market Adoption as Researchers Analyze Genomic Data on More Than a Quarter-Million Samples in Secure Private Cloud 4QIAGEN Demonstrates Expanded Bioinformatics Workflows at ASHG; Strong Market Adoption as Researchers Analyze Genomic Data on More Than a Quarter-Million Samples in Secure Private Cloud 5QIAGEN Demonstrates Expanded Bioinformatics Workflows at ASHG; Strong Market Adoption as Researchers Analyze Genomic Data on More Than a Quarter-Million Samples in Secure Private Cloud 6