Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... flexible and easy to use ... control all members of the ... features a clear and easy-to-follow ... setup, user-friendly and highly sophisticated ...
Strip Removal Tool 25/Box...
The bench-top stand comfortably holds up to 6 Finnpipette Digital single- and multichannel pipettes. The crossbars are made of a grippy material to keep the pipettes firmly in place. Individual shelf...
... Analysis Note: Protein determined by Biuret Physical ... mM Tris-HCl, pH 7.6, 1 mM MgCl ... Preparation Unit Definition: One unit will ... minute at pH 9.8 at 37 C. ...
Biology Products:
(Date:4/21/2015)... , April 21, 2015 ... government policies are boosting access control systems market in ... According to a recently published report by TechSci Research ... ", the access control systems market in ... billion by 2020.The access control systems market in the ...
(Date:4/14/2015)... April 14, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... the 2015 New York Design Awards under the category  ... York City Design Awards are part of a global ... 2,500 ratings from the marketplace, industry and judging panel. ...
(Date:4/8/2015)... , April 8, 2015  Infinisource, a ... and services, and Morpho, a leading supplier of ... to produce the market,s most advanced biometrically-enabled time ... iSolved NXG time clock is setting a bold, ... labor data for the small and mid-size employer. ...
Breaking Biology News(10 mins):Saudi Arabia Access Control Systems Market to Touch USD1.2 Billion by 2020 Says TechSci Research 2Saudi Arabia Access Control Systems Market to Touch USD1.2 Billion by 2020 Says TechSci Research 3NXT-ID's Wocket Smart Wallet Nominated for 2015 New York Design Awards in 'Product Design- Technology' 2NXT-ID's Wocket Smart Wallet Nominated for 2015 New York Design Awards in 'Product Design- Technology' 3iSolved Time Clock Offers Unmatched Accuracy due to Morpho Biometrics 2iSolved Time Clock Offers Unmatched Accuracy due to Morpho Biometrics 3
... JoVE, the Journal of Visualized Experiments will ... understand the genes that govern food-related behavior in honey ... one-step closer toward understanding and perhaps changing ... "Our technique has already helped to unravel [the] complex ...
... to clean up city parks, or scale back their driving ... for granted and ride free on the efforts of others. ... fund it. Or they run their lawn sprinklers during a ... consumption. A new report in Psychological Science in ...
... global water crisis that already has left almost 800 million ... many more in the years ahead -- are the topic ... Chemical & Engineering News . C&EN is the weekly newsmagazine ... Alex Scott, C&EN,s senior editor for Europe, points out ...
Cached Biology News:Honey bee gene targeting offers system to understand food-related behavior 2Trust in leaders, sense of belonging stir people to safeguard common goods, analysis shows 2Trust in leaders, sense of belonging stir people to safeguard common goods, analysis shows 3
(Date:4/24/2015)... DIEGO , April 24, 2015  Pfenex Inc. ... the development of biosimilar therapeutics including high value and ... its follow-on public offering of 6,000,000 shares of its ... $15.50 per share. Of the shares being offered, 2,610,000 ... shares are being offered by existing stockholders. Pfenex will ...
(Date:4/24/2015)... Seoul Semiconductor announced the expansion of ... the lighting market. In recent months, there ... in emerging markets such as Russia, South America, ... applications such as streetlight and area lighting, tunnel ... launched in 2005 the Acrich technology from Seoul ...
(Date:4/23/2015)... , April 23, 2015 /CNW/ - A new and ... award from North America,s ... Comparison won Silver in the "Sustainability, service" category ... The Brandcheck "Competitor Comparison" is a service that ... American and Global peers. This benchmarking process shows ...
(Date:4/23/2015)... WuXi PharmaTech (Cayman) Inc. (NYSE: WX ), a ... the pharmaceutical, biotechnology and medical device industries, with operations ... the United States , today announced that it ... 2015 after the New York Stock Exchange closes on ... May 14, 2015 Shanghai time). The earnings release will ...
Breaking Biology Technology:Pfenex Inc. Announces Pricing Of Follow-on Offering 2Acrich Technology from Seoul Semiconductor Adopted in Installations Worldwide 2WuXi PharmaTech Schedules First-Quarter 2015 Earnings Release 2WuXi PharmaTech Schedules First-Quarter 2015 Earnings Release 3