Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Rabbit polyclonal to Kallikrein 1 ( Abpromise for all tested applications). Antigen: Full length native kallikrein from tissue (Human) Entrez Gene ID: 3816 Swiss Protein ID: P06870...
Biotin d anti-mouse Tim-1...
... Kir2.1 protein. The epitope is specific ... in any other known protein.,SPECIES REACTIVITIES: ... in rabbit, bovine, porcine and guinea ... rat and mouse (17/19 residues) and ...
Mouse monoclonal [J53] to Thyroid Hormone Receptor beta 1 ( Abpromise for all tested applications). entrezGeneID: 7068 SwissProtID: P10828...
Biology Products:
(Date:7/8/2015)... SAN DIEGO , July 8, 2015 /PRNewswire/ ... of cell-free molecular diagnostics, today announced the launch ... of the Company,s Precision Cancer Monitoring℠ (PCM) technology ... patients receiving one or a combination of the ... and Opdivo® (nivolumab), a PD-1 inhibitor. The 50-patient ...
(Date:7/7/2015)... -- NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or the "Company") ... announces a revised version of one of its first 30 second ... CNBC in New York , Chicago ... San Francisco metro areas.    , , ... replace all the cards in your wallet and keep your identity ...
(Date:6/30/2015)... 30, 2015 To bolster its efforts and commitment ... announced today the addition of two new team members. ... advisor and David Raviv will act as head ... Corp.,s commitment to providing the most secure solutions for the ... co-founded Layer 7 Technologies, a provider of security and management ...
Breaking Biology News(10 mins):Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 2Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 3Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 4Wocket Smart Wallet Commercials Airing on CNBC to Showcase This Summer's Must- Have Tech Product 2Wocket Smart Wallet Commercials Airing on CNBC to Showcase This Summer's Must- Have Tech Product 3HYPR Corp. Expands Biometric Authentication Team with Enterprise All Stars 2HYPR Corp. Expands Biometric Authentication Team with Enterprise All Stars 3
... altered osteoporosis drug may be useful in fighting malaria, researchers ... other parasitic protozoa, the drug readily crosses into the red ... The drug works at very low concentrations with no observed ... Proceedings of the National Academy of Sciences . ...
... A group of scientists from across the world have come ... into how fructose causes obesity and metabolic syndrome, more commonly ... performed in lab animals, researchers found that fructose can be ... One form appears to be responsible for causing how fructose ...
... CA--A study of the tropical coral reef system along the ... could threaten the long-term health of the reefs. Led by ... was published in the journal Coral Reefs (online ... loss of predatory fish leads to a cascade of effects ...
Cached Biology News:Modified bone drug kills malaria parasite in mice 2Research offers insight to how fructose causes obesity and other illness 2Coral reef study traces indirect effects of overfishing 2
(Date:8/3/2015)... August 3, 2015 E-QURE Corp. ... of its Bio-electrical Signal Therapy device ("BST Device"), a ... hard to heal chronic wounds, today announced that the ... an Israeli distributor specializing in medical devices, for the ... Chemipal is a 70 years old, sales, marketing and ...
(Date:8/3/2015)... Aug. 3, 2015 /PRNewswire/ - RepliCel Life Sciences Inc. (TSX.V: ... on the development of autologous cell therapies, announced today that ... the InvestMNT conference held in Minneapolis, Minnesota ... time. Hall,s presentation will highlight RepliCel,s 18-month milestones including CE ... Europe , clinical data from both RCT-01 (tendon) ...
(Date:7/31/2015)... , ... July 31, 2015 , ... ... competitive market analysis and premium industry insights on the global resorcinol industry. The ... a collective study of vivid market scenarios and analysis of primary and secondary ...
(Date:7/30/2015)... ... , ... Ralco is honored to announce that it is the primary sponsor ... August 5-9 in Marshall. The Ralco Enrichment Center is an interactive experience where the ... their daily lives. This unique exhibit also features a birthing center for fair goers ...
Breaking Biology Technology:E-QURE Corp Signs Second Distribution Agreement in Israel 2E-QURE Corp Signs Second Distribution Agreement in Israel 3RepliCel Presenting at InvestMNT Investor Conference in Minneapolis 2Resorcinol Market to Grow at 6% CAGR to 2019 Says New Research Report at ReportsnReports.com 2Resorcinol Market to Grow at 6% CAGR to 2019 Says New Research Report at ReportsnReports.com 3Resorcinol Market to Grow at 6% CAGR to 2019 Says New Research Report at ReportsnReports.com 4Ralco Announces Primary Sponsorship of Ralco Enrichment Center at Lyon County Fair 2