Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... transcripts with the translation boosting Cap 1 ... capped (versus 40% to 80% capped using ... 2 hours. mScript™ also features the Cap ... be up to 50% more efficient in ...
... The Baculovirus Expression System with Gateway™ ... pFastBac™ plasmids containing the polyhedrin promoter. ... the baculovirus genome (bacmid DNA) by ... coli cells. The recombinant bacmid DNA ...
Immunogen: Synthetic peptide: M(1) C V P R S G L I L S(11) Storage: -20 C, Avoid Freeze/Thaw Cycles...
Request Info...
Biology Products:
(Date:12/15/2016)... --  WaferGen Bio-systems, Inc. (NASDAQ: WGBS ... that on December 13, 2016, it received a letter ... Market LLC which acknowledged that, as of December 12, ... had been at $1.00 or greater for ten consecutive ... Rule 5550(a)(2) of the Nasdaq Stock Market. ...
(Date:12/15/2016)... Dec. 14, 2016 "Increase in mobile transactions ... The mobile biometrics market is expected to grow from ... by 2022, at a CAGR of 29.3% between 2016 ... as the growing demand for smart devices, government initiatives, ... "Software component is expected to grow at a ...
(Date:12/7/2016)... -- According to a new market research report "Emotion Detection and ... Recognition), Service, Application Area, End User, And Region - Global Forecast to 2021", ... Billion in 2016 to USD 36.07 Billion by 2021, at a Compound Annual ... ... MarketsandMarkets Logo ...
Breaking Biology News(10 mins):
(Date:1/12/2017)... ... January 12, 2017 , ... Huffman Engineering, Inc. , ... who will work in the company’s Lincoln office as a chemical engineer. In ... control systems for customers in the life science manufacturing and water/wastewater industries. , Prior ...
(Date:1/12/2017)... The report "Direct-Fed Microbials Market by Type (Lactic Acid Bacteria and ... Region - Global Forecast to 2022", published by MarketsandMarkets, the global market is ... reach USD 1,399.6 Million by 2022, at a CAGR of 6.96% from 2016. ... ... MarketsandMarkets Logo ...
(Date:1/11/2017)... BELLINGHAM, Washington, USA (PRWEB) , ... January 11, ... ... SPIE, the international society for optics and photonics , are commending the ... and photonics, following the signing Friday by the President of the American Innovation ...
(Date:1/11/2017)... ... 11, 2017 , ... IsoPlexis Corporation (IsoPlexis), a ... measure the proteomic function of individual cells in patients, today announced it was ... the National Institute on Aging of the National Institutes of Health to develop ...
Breaking Biology Technology: