Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... XpressPack Luminescent Detection System is intended for ... DNA generated by an in-house validated method ... a selected target of interest. ... System is a hybridization capture assay designed ...
... Dish uses include large-scale colony-counting and plaque-lifting, ... Flexys TM automated colony picking and ... new product number, created to easily match ... yet, please order under the old Sigma-Aldrich ...
Mouse Anti-Human Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (KIR2DL4 Monoclonal Antibody Family: New...
BD BioCoat Laminin 150 mm Culture Dishes...
Biology Products:
(Date:1/22/2015)... , Jan. 9, 2015 Valid S.A. ("Company") (BM&FBOVESPA: VLID3 ... in general the State of Washington,s ... a new enrollment and central issuance system for driver,s licenses ... The project planning and development will start in January ...
(Date:1/22/2015)... 13, 2015  Today, FreeWavz ( www.FreeWavz.com ), the ... campaign on Fundable, https://www.fundable.com/freewavz . FreeWavz will ... capacity to meet customer demand. Logo ... http://photos.prnewswire.com/prnh/20150113/168790 Invented by Dr. ...
(Date:1/22/2015)...  BellBrook Labs, a leader in high throughput screening ... a TR-FRET (time resolved Forster resonance energy transfer) ... high throughput screening assay for glycosyltransferases and other ... sensitive detection of hundreds of human and microbial ...
Breaking Biology News(10 mins):Valid USA Signs Contract For Washington Driver's License Issuance 2FreeWavz Launches on Fundable to Drive Speed-to-Market in 2015 2BellBrook Labs Launches a High Throughput Screening Assay for Glycosyltransferases with TR-FRET Readout 2
... Hawai,i at Manoa researcher has published the first-ever assessment of ... the nation,s agriculture industry and the environment, should they ever ... in the American Malacological Bulletin is authored by ... for Conservation Research and Training (CCRT) and his team. ...
... A new approach to windows that could let in ... to 99% in buildings in Tropical regions without losing ... the International Journal of Engineering Systems Modelling and ... in the School of Environment, Resources and Development, at ...
... -- but the head shape and overall size of rodents ... Illinois at Chicago ecologist has tied these changes to human ... by Oliver Pergams, UIC research assistant professor of biological sciences, ... Pergams said that such size-and-shape changes in mammals, occurring ...
Cached Biology News:Opening a new window on daylight 2Rodent size linked to human population and climate change 2
(Date:3/5/2015)... (PRWEB) March 05, 2015 North ... Pierre Noel, M.D., Professor of Medicine, Mayo Clinic ... Company’s Board of Directors. , Entegrion’s ... extremely fortunate to have Dr. Noel, a distinguished ... healthcare organization, join Entegrion’s Board. His expertise in ...
(Date:3/5/2015)... and Markets ( http://www.researchandmarkets.com/research/4ld5nw/mature_biotech ) has announced ... New Therapy Ventures Pave the Way for Success" ... companies - Gilead (GILD), Amgen (AMGN), Biogen Idec (BIIB) ... positive return and hence increased the interest of biotech ... indication where the high treatment cost justifies the need. ...
(Date:3/5/2015)... 2015 The next implants made from ... CE mark (European) approval. The CE mark is necessary ... (EFTA) and the European Union. Following the Class IIb ... to implants supplied by the Turkey-based company Osimplant for ... Osimplant's Cervical Expandable Bladed HA PEEK Cage line of ...
(Date:3/4/2015)... , March 4, 2015 In an article ... UPMC Center for Health Security review the clinical aspects ... be used as bioweapons. The article, "Clinical Management of ... on the website of the New England Journal ... Eric Toner , and Tom Inglesby—review the clinical ...
Breaking Biology Technology:Entegrion Announces Appointment of Pierre Noel, MD, to Its Board of Directors 2Mature Biotech Outlook 2015: New Therapy Ventures Pave the Way for Success 2Mature Biotech Outlook 2015: New Therapy Ventures Pave the Way for Success 3Invibio’s PEEK-OPTIMA® HA Enhanced Gains Momentum: New Implant Receives European Approval 2Invibio’s PEEK-OPTIMA® HA Enhanced Gains Momentum: New Implant Receives European Approval 3Latest Clinical Information On Bioterrorism Threats 2