Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Services include: ,ISH Protocol ... Conditions Analyses ,RNA and DNA ... Cells and Tissues ,Double Labeling ... Cells and Tissues ,RNA and ...
Request Info...
Request Info...
Request Info...
Biology Products:
(Date:3/20/2017)... March 20, 2017 PMD Healthcare announces the ... and Wellness Management System (WMS), a remote, real-time lung ... 2010, PMD Healthcare is a Medical Device, Digital Health, ... dedicated to creating innovative solutions that empower people to ... intent focus, PMD developed the first ever personal spirometer, ...
(Date:3/7/2017)... Brandwatch , the leading social intelligence company, today ... to uncover insights to support its reporting, help direct future ... UK,s leading youth charity will be using Brandwatch Analytics social listening ... better understanding of the topics and issues that are a priority ... ...
(Date:3/2/2017)... LONDON , March 2, 2017 Who ... infringement lawsuits? Download the full report: https://www.reportbuyer.com/product/4313699/ ... ON THE FINGERPRINT SENSOR FIELD? Fingerprint sensors using ... smartphones. The fingerprint sensor vendor Idex forecasts an increase ... in mobile devices and of the fingerprint sensor market ...
Breaking Biology News(10 mins):
(Date:3/24/2017)... On Thursday, March 23, 2017, ... down 0.07%; the Dow Jones Industrial Average edged 0.02% ... closed at 2,345.96, marginally dropping 0.11%. US markets saw ... 4 sectors finished in red, and 1 sector ended ... reports coverage on the following Biotechnology equities: BioDelivery Sciences ...
(Date:3/24/2017)... 2017 Agenus Inc. (NASDAQ: AGEN), an immuno-oncology ... cancer vaccines, today announced participation at the following conferences: ... Blair and Maidstone Life Sciences conference "Cancer Immunotherapy Conference" ... New York, NY . Agenus will participate ... 9:40 am: Robert B. Stein , M.D., Ph.D., ...
(Date:3/23/2017)... ... March 23, 2017 , ... Lajollacooks4u is proud to announce it has become the premiere team-building ... challenges for companies around the world, such as Illumina, HP and Qualcomm, and is ranked ... its increasing popularity is due to its new team building format, a way for teams ...
(Date:3/23/2017)... , March 23, 2017  Northwest Biotherapeutics ... DCVax® personalized immune therapies for solid tumor cancers, ... $7.5 million financing it announced last Friday, March ... to several institutional investors securities totaling 28,843,692 shares, ... share, and 10,000,000 shares of Class C Warrants ...
Breaking Biology Technology: