Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... nature of proteomics demands the detection of ... performance of the AXIMA-CFRplus with improved resolution ... ppm) provides increased confidence in protein identification. ... enhanced sensitivity, automated sample target handling and ...
...
... MALDI O-TOF creates a new category for ... platform that has been licensed to the ... Manitoba. , As the first single MALDI-TOF ... collisional cooling, the prOTOF 2000 represents a ...
Rat Dermal Fibroblasts (RDF) (>500,000 cells)...
Biology Products:
(Date:2/13/2017)... , Feb. 13, 2017  RSA Conference -- ... platform that is designed to enhance fraud detection ... release in the RSA Fraud & Risk Intelligence ... organizations to leverage additional insights from internal and ... to better protect their customers from targeted cybercrime ...
(Date:2/8/2017)... Feb. 8, 2017 About Voice Recognition Biometrics ... match it against a stored voiceprint template. Acoustic ... cadence, and tone are compared to distinguish between ... installation, as most PCs already have a microphone ... Voice recognition biometrics are most likely to be ...
(Date:2/8/2017)... , Feb. 7, 2017 Report Highlights ... by 2021 from $8.3 billion in 2016 at a ... to 2021. Report Includes - An overview of ... market trends, with data from 2015 and 2016, and ... - Segmentation of the market on the basis of ...
Breaking Biology News(10 mins):
(Date:2/16/2017)... DIEGO , Feb. 16, 2017  Dermata ... innovative products to treat a variety of dermatological ... million Series 1a financing and entered into a ... (SVB).  Dermata intends to use the capital for ... making major advancements in the treatment of serious ...
(Date:2/16/2017)... ... February 16, 2017 , ... AxioMed announced today the ... Harvard trained surgeon, completed the procedure on Monday, Jan. 30 at Andrews Memorial ... physician suffering from degenerative disc disease with radiculomyelopathy, as a result of degenerative ...
(Date:2/16/2017)... 2017  Rhythm, a biopharmaceutical company developing ... result in life-threatening metabolic disorders, today announced ... round of financing with existing investors including ... Enterprise Associates, Pfizer Venture Investments, Third Rock ... fund. Rhythm will use the proceeds to ...
(Date:2/16/2017)... ... February 16, 2017 , ... ... extended its industry leading Biochemistry Services specifically targeting the rapidly growing needs ... methods for the biochemical and biosimilar characterization , product-related impurity characterization, ...
Breaking Biology Technology: