Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Rabbit polyclonal to FOXJ2 ( Abpromise for all tested applications). entrezGeneID: 55810 SwissProtID: Q9P0K8...
Selenoprotein P Purified Anti-Mouse clone 35, Isotype Mouse IgG 2b , 50 µg Consult technical datasheet for details....
Mouse monoclonal [3B6] to HSV1 + HSV2 ICP5 Major Capsid Protein ( Abpromise for all tested applications)....
Phosphotyrosine IgG mouse monoclonal antibody: Alkaline Phosphatase conjugate...
Biology Products:
(Date:11/28/2016)... -- "The biometric system market projected ... biometric system market is in the growth stage and ... The biometric system market is expected to be valued ... of 16.79% between 2016 and 2022. Government initiative in ... smartphones, rising use of biometric technology in financial institutes ...
(Date:11/21/2016)...   Neurotechnology , a provider of high-precision ... that the MegaMatcher On Card fingerprint matching algorithm ... NIST Minutiae Interoperability Exchange (MINEX) III ... of the evaluation protocol. The ... fingerprint templates used to establish compliance of template ...
(Date:11/16/2016)... Nov. 16, 2016 Sensory Inc ., ... security for consumer electronics, and VeriTran , ... retail industry, today announced a global partnership that ... to authenticate users of mobile banking and mobile ... software which requires no specialized biometric scanners, ...
Breaking Biology News(10 mins):
(Date:12/5/2016)... 2016 Research and Markets has announced ... Markets and Companies" to their offering. ... , , ... various -omics technologies such as proteomics and metabolomics. Molecular diagnostics technologies ... also based on biomarker. Currently the most important applications ...
(Date:12/5/2016)... 2016 According to the ... Products (Consumable, Instruments, Automated Cell Expansion System), Cells ... Cell Research, Cancer, and Cell-Based Research), End-users (Biopharmaceutical ... Global Revenue, Trends, Growth, Share, Size and Forecast ... global cell expansion market is expected to reach ...
(Date:12/5/2016)... RAPIDS, Mich. , Dec. 5, 2016 NxGen MDx announced ... "By bringing the test in house, we,ve been able to improve customer ... down for patients," says Alan Mack , CEO of NxGen MDx. ... , , ... in test volume has led to more job opportunities at the Grand ...
(Date:12/5/2016)... YORK , December 5, 2016 ... player worldwide, with almost $108 billion of revenue and ... $170 billion were spent on global biopharmaceuticals, and this ... This morning, Stock-Callers.com has lined up these four equities ... ), ACADIA Pharmaceuticals Inc. (NASDAQ: ACAD ), ...
Breaking Biology Technology: