Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
12(S)-HETE-d8 is used as an internal standard for the quantification of 12(S)-HETE by stable isotope dilution mass spectrometry....
Full-length cDNA 5-PRIME end of clone CS0DE013YM09 of Placenta of Homo sapiens (human). [Source:Uniprot/SPTREMBL;Acc:Q86TS7] Antigen: Recombinant Protein Epitope Signature Tag (PrEST)....
No description available in Ensembl Antigen: Recombinant Protein Epitope Signature Tag (PrEST)....
... deuterium atoms at the 9, 10, 12, and ... an internal standard for the quantification of 9(S)-HODE ... by the lipoxygenation of linoleic acid in both ... atherosclerotic plaques, as an esterified component of membrane ...
Biology Products:
(Date:7/29/2014)... new book that brings together two of the major ... profile of insect fossils through stunning photographs and unique ... James E Jepson, details the incredible preservation and diversity ... scene for what these remarkable fossils can tell us ... future of our planet. Like the mosquito in Jurassic ...
(Date:7/29/2014)... Many different types of cell, including sperm, bacteria ... as flagella. These protrusions, about one-hundredth of a ... move through fluid. Similar, shorter structures called cilia ... where they perform roles such as moving liquids ... are remarkably versatile: they transport mucus and expel ...
(Date:7/28/2014)... About 100 drugs already approved by the U.S. Food ... prevent the growth of certain bacterial pathogens inside human ... Mediterranean spotted fever. The findings, published in mBio ... for Microbiology, demonstrate a new way of identifying non-antibiotic ... , A handful of drugs on the list ...
Breaking Biology News(10 mins):Unique images bring fossil insects back to life 2Microscopic rowing -- without a cox 2Microscopic rowing -- without a cox 3New route to identify drugs that can fight bacterial infections 2
... as many infant deaths than previously estimated, according to a ... Control and Prevention. , The analysis, published today in Pediatrics, ... 37 completed weeks gestation, contributed to more than one-third of ... "We have long known that babies born too soon face ...
... store iron, a valuable discovery for scientists working to improve ... worldwide problem of iron deficiency and malnutrition in humans. , ... vascular system of the seed of Arabidopsis, a model plant ... vacuole, a plant cell's central storage site. The researchers also ...
... University of Manchester researchers are recruiting people with backache ... ?in the first ever study to discover if therapeutic ... and his team at the University's Centre for Rehabilitation ... sciatica for less than 12 weeks, are not pregnant ...
Cached Biology News:New study: Preterm birth causes one-third of all infant deaths 2Plant studies reveal how, where seeds store iron 2
(Date:7/29/2014)... SPRINGS, Colo. , July 29, 2014 /PRNewswire/ ... specializing in cannabis formulation-based drug development and related ... York Times for taking a strong position in ... its Sunday, July 27, 2014 publication.  The New ... editorials and articles this week exploring the issue ...
(Date:7/29/2014)... Philadelphia’s newest entrepreneurial incubation space is ready for business, and ... Center @3401 , a collaborative effort of Drexel University ... help attract and nurture start-up businesses in the region, officially ... , The Innovation Center @3401 (ic@3401), which is located at ... home of DreamIt Ventures and Point.io ...
(Date:7/29/2014)... Quorum Review IRB, the industry leader ... by the International Association of Six Sigma ... Deployment Program. The citation recognizes robust organizational enhancements ... Lean Six Sigma program was evaluated by IASSC ... designation is a public statement of excellence and ...
(Date:7/29/2014)... CA (PRWEB) July 29, 2014 ... Pipette.com’s centrifugation product selection. Eppendorf 5427 R is geared ... and DNA – it is targeted towards work requiring ... Centrifuge 5427 R as it compliments their extensive 16, ... Eppendorf line of microcentrifuge tubes, PCR tubes, PCR strip ...
Breaking Biology Technology:Cannabis Science, Inc. (CBIS) Applauds New York Times Editorial Board Stance on 'Repealing Prohibition, Again'; NYT Editorial Is Bell Weather of Change 2Cannabis Science, Inc. (CBIS) Applauds New York Times Editorial Board Stance on 'Repealing Prohibition, Again'; NYT Editorial Is Bell Weather of Change 3Innovation Center @3401 Opens for Business; DreamIt Ventures and Point.io First Residents 2Innovation Center @3401 Opens for Business; DreamIt Ventures and Point.io First Residents 3Quorum Review IRB Accredited by IASSC for Lean Six Sigma Deployment Program 2Quorum Review IRB Accredited by IASSC for Lean Six Sigma Deployment Program 3International Pipette Distributor, Pipette.com Announces the Addition of the Eppendorf Centrifuge 5427 R to Their Product Portfolio 2