Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... SYBR Green II RNA gel ... gel stain that has bright fluorescence when ... gels, making it ideal for use with ... scanners or standard UV transilluminators. A 500 ...
... records analyzes and reports the data from any ... the a chart recorder. The final data is ... The end-point selection is automatic for Systolic, Mean, ... computed. The user is always in the position ...
... is taking automated patch clamping to a new ... to generate thousands of high quality data points ... in ion channel drug discovery and safety testing. ... afforded by conventional patch clamping can now be ...
... Reagents for the differentiation of mouse ... cell bodies exist in the midbrain, where ... nigra, the ventral tegmental area, and the ... rise to extensive forebrain dopamine innervation ( ...
Biology Products:
(Date:9/2/2014)... DURHAM, N.C. -- When you accidentally touch a hot ... know the basic neural circuits involved in sensing and ... out the molecular players. , Duke researchers have made ... molecule involved in pain in worms, and have built ... Sept. 2 in Nature Communications , may help ...
(Date:9/1/2014)... quality in the U.S. has improved steadily in recent ... overall dietary quality remains poor and disparities continue to ... new study from Harvard School of Public Health (HSPH). ... date that the extensive efforts by many groups and ... payoff, but it also indicates that these efforts need ...
(Date:9/1/2014)... minutes after birth, every child in the U.S. undergoes ... of conditions, including sickle cell disease. Thousands of children ... meaning many suffer and die from the disease each ... halt to at least some of those deaths. ... working in the lab of George Whitesides, the Woodford ...
Breaking Biology News(10 mins):Surprising new role for calcium in sensing pain 2Surprising new role for calcium in sensing pain 3Quality of US diet shows modest improvement, but overall remains poor 2Quality of US diet shows modest improvement, but overall remains poor 3Faster, cheaper tests for sickle cell 2Faster, cheaper tests for sickle cell 3
... created to provide a haven for both protected species ... Gothenburg have analysed species living on the seabed (benthic ... marine areas require special protection., , "It,s not possible ... park. That,s why I,ve done what experienced mushroom pickers ...
... This release is available in German . ... the carbohydrates they produce through photosynthesis in the leaves. However, ... heart to help transport this vital fuel. Instead, they use ... with colleagues from the Carnegie Institution for Science in California, ...
... of 34 institutions in 15 countries contributing to the measurements ... network, InGOS. , The network focuses on providing accurate information ... for a more vigorous climate action. In order to ... of greenhouse gas emissions is essential and not only ...
Cached Biology News:Life on Kosterhavet's seabed analyzed 2Sugar pump in plants identified 2Sugar pump in plants identified 3DTU is participating in a European network on measurement of greenhouse gases 2
(Date:8/30/2014)... (PRWEB) August 31, 2014 The ... a professional and in-depth study on the current ... Global and China. , The report provides a ... and industry chain structure. Global market analysis and ... focus on history, developments, trends and competitive landscape ...
(Date:8/29/2014)... According to a new market report published ... market was valued at USD 3,754.6 million in 2012 and ... 2019at a CAGR of 5.9% from 2013 to 2019. , ... is afflicted by bone and joint disorders, and this number ... has and will continue to increase the demand for orthobiologics. ...
(Date:8/29/2014)... (PRWEB) August 29, 2014 Three ... Energy's 2014 Hydrogen Production R&D Award ... by splitting water using sunlight. , Shared with ... and the University of Nevada, Las Vegas (UNLV), ... developing models of photoelectrochemical solar-hydrogen production and corrosion ...
(Date:8/28/2014)... SPIE Fellow Glenn Boreman, Professor and ... and Director of the Center for Optoelectronics and Optical ... and co-founder and Chairman of the Board of Plasmonics, ... Vice President of SPIE, the international society for optics ... recent election results at the Annual General Meeting of ...
Breaking Biology Technology:Electrical Insulating Varnish Market World, China Regional Analysis & 2020 Forecasts Available at DeepResearchReports.com 2Electrical Insulating Varnish Market World, China Regional Analysis & 2020 Forecasts Available at DeepResearchReports.com 3Global Orthobiologics Market to Reach $5,519.9 Million by 2019: Transparency Market Research 2Global Orthobiologics Market to Reach $5,519.9 Million by 2019: Transparency Market Research 3Livermore Team Awarded for Hydrogen Production Research 2Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2