Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Gasket slide kit (1x 22K gasket/slide) G2534-60003 ... or Gasket slide kit (2x 11K ... slides offered in either 11K or 22K microarray feature ... gaskets are carefully fabricated and batch tested to ensure ...
... CLS number is a new ... match Cornings product number. If ... order under the old Sigma-Aldrich ... service for assistance. ID clarifier: ...
... self locking design in ice/water bath ... product number, created to easily match ... availability yet, please order under the ... customer service for assistance. ID clarifier: ...
... Microarray Kit (V2), 2 x 11K ... expression of many thousands of yeast ... important biological processes. Each microarray contains ... ORFs from the S288C strain of ...
Biology Products:
(Date:4/5/2017)... , April 5, 2017  The Allen Institute for ... Cell Explorer: a one-of-a-kind portal and dynamic digital window ... imaging data, the first application of deep learning to ... stem cell lines and a growing suite of powerful ... for these and future publicly available resources created and ...
(Date:4/3/2017)... WASHINGTON , April 3, 2017 /PRNewswire-USNewswire/ ... single-cell precision engineering platform, detected a statistically ... cell product prior to treatment and objective ... highlight the potential to predict whether cancer ... prior to treatment, as well as to ...
(Date:3/29/2017)... , March 29, 2017  higi, the health ... in North America , today announced ... and the acquisition of EveryMove. The new investment and ... set of tools to transform population health activities through ... lifestyle data. higi collects and secures data ...
Breaking Biology News(10 mins):
(Date:10/10/2017)... ... October 10, 2017 , ... San Diego-based team building and cooking events ... announced today. The bold new look is part of a transformation to increase ... a significant growth period. , It will also expand its service offering from its ...
(Date:10/10/2017)... California (PRWEB) , ... October 10, 2017 , ... Dr. ... speaking at his local San Diego Rotary Club. The event entitled ... Diego, CA and had 300+ attendees. Dr. Harman, DVM, MPVM was joined by ...
(Date:10/10/2017)... ... October 10, 2017 , ... USDM Life ... for the life sciences and healthcare industries, announces a presentation by Subbu Viswanathan ... The presentation, “Automating GxP Validation for Agile Cloud Platforms,” will present a revolutionary ...
(Date:10/9/2017)... , ... October 09, 2017 , ... The award-winning American ... broadcast first quarter 2018. American Farmer airs Tuesdays at 8:30aET on RFD-TV. , ... faced with the challenge of how to continue to feed a growing nation. At ...
Breaking Biology Technology: