Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Bethyl Laboratories packages antibodies, conjugates and calibrators to provide quantitative ELISA kits. Each kit contains the following components, sufficient for 1000 single well assays....
quantitation of phosphatase activity, evaluation of hits and leads from HTS...
Bethyl Laboratories packages antibodies, conjugates and calibrators to provide quantitative ELISA kits. Each kit contains the following components, sufficient for 1000 single well assays....
Bethyl Laboratories packages antibodies, conjugates and calibrators to provide quantitative ELISA kits. Each kit contains the following components, sufficient for 1000 single well assays....
Biology Products:
(Date:8/28/2014)... DURHAM, N.C. -- Scientists have identified the developmental on-off ... microbes that produce more than two-thirds of the world,s ... would be to see whether it is possible to ... efficient. , The study, appearing August 28 in ... a small molecule called cyclic-di-GMP and a larger protein ...
(Date:8/28/2014)... compounds that could positively impact the global ... possible, thanks to researchers in Penn State,s ... suppository made from the seaweed-derived food ingredient ... Tenofovir provides a woman-initiated, drug-delivery vehicle that ... transmitted infections during unprotected heterosexual intercourse, the ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3Sensory-tested drug-delivery vehicle could limit spread of HIV, AIDS 2Sensory-tested drug-delivery vehicle could limit spread of HIV, AIDS 3Inter-dependent networks stress test 2
... 251 million years ago was preceded by elevated extinction rates ... recovery that lasted for millions of years. New research by ... in atmospheric oxygen levels was likely a major reason for ... , Earth's land at the time was still massed in ...
... measurement techniques from a high-altitude aircraft, scientists detected two ... of rain forest near the Kilauea Volcano in the ... of the Carnegie Institution's Department of Global Ecology, explained: ... used them to tell which species dominated specific areas. ...
... Helsinki, show that atomic structures can reveal evolutionary history ... for the dinosaurs and reptiles. Their article is published ... , These "molecular fossils" also revealed that viruses and ... plausible explanation may be that viral building blocks served ...
Cached Biology News:Scientists reveal the shape of a protein that helps retroviruses break into cells 2Scientists reveal the shape of a protein that helps retroviruses break into cells 3Finding hidden invaders in a Hawaiian rain forest 2Finding hidden invaders in a Hawaiian rain forest 3
(Date:8/28/2014)... USA (PRWEB) August 28, 2014 SPIE ... of Physics and Optical Science and Director of the ... of North Carolina at Charlotte, and co-founder and Chairman ... to serve as the 2015 Vice President of SPIE, ... 2014 President Philip Stahl announced recent election results at ...
(Date:8/28/2014)... new research platform uses a laser to ... undergoing stress and heating, an approach likely ... microelectronics and batteries., This new technique, called ... heating and the surface stress of microscale ... discussed the merits of surface-stress influence on ...
(Date:8/28/2014)... Aug. 28, 2014  Next month, executives from clinical trial ... industry events beginning with Patient-Centered Clinical Trials 2014 , ... Boston , September 4-5. Patient recruitment experts ... Aaron Fleishman will share insights on the benefits of ... of tactics – from media to mobile apps – can ...
(Date:8/28/2014)... new work by a Florida State University research team ... take your temperature, emit white light, and convert photon ... looks like a butterfly. , Biwu Ma, associate professor ... the FAMU-FSU College of Engineering, created the molecule in ... to discover that his creation has many other unique ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2