Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... DeCypher combines enterprise-scale sequence analysis software with ... bioinformatics analyses. With DeCypher, you can perform searches ... ESTs vs NCBI NT database in under 6 ... to genomic DNA Use HMM analysis ...
Mouse monoclonal antibody to FMN2 - formin 2...
Rabbit polyclonal to SMARCA2 / BRM - ChIP Grade ( Abpromise for all tested applications). entrezGeneID: 6595 SwissProtID: P51531...
Mouse monoclonal [CAT-2] to Chloramphenicol Acetyltransferase...
Biology Products:
(Date:6/30/2015)... -- Genisphere announced Tom Bliss ... develop Genisphere,s therapeutics capabilities and portfolio. Mr. Bliss comes ... of the last 25 years in leadership positions at ... & Johnson. Tom started his career in Investment Banking, ... He graduated from Dartmouth College with a BA in ...
(Date:6/25/2015)... PRINCETON, N.J. , June 25, 2015  TAKE ... awarded a patent by the United States Patent and ... Data Standardization". This process leverages TAKE Solutions, Clinical Accelerators ... by over 50% (when compared to standardization without the ... At the heart ...
(Date:6/24/2015)... MARTIGNY, Switzerland , June 24, 2015 /PRNewswire/ ... strategic partnership with emerging biometric password solution one ... http://photos.prnewswire.com/prnh/20150623/225014LOGO one face in, ... offers a ground-breaking and affordable multifactor-authentication biometric answer ... speaker recognition technology, provided in partnership with KeyLemon, ...
Breaking Biology News(10 mins):Genisphere Appoints New CEO, Thomas Bliss 2Genisphere Appoints New CEO, Thomas Bliss 3TAKE Solutions Awarded Patent By USPTO 2KeyLemon Announces Partnership With Biometric Password Solution onefacein 2
... world would help stave off an imminent global extinction ... Proceedings of the National Academy of Sciences ( www.pnas.org ... member organizations of the Alliance for Zero Extinction (AZE ... with imminent extinction, each of which is in need ...
... has its roots in yielding more food to feed more ... , His team's study appears in ... , The team made tomato plants over-express the gene, ... resulted in roots making better use of limited water, said ...
... and the National Human Genome Research Institute (NHGRI), ... (NIH), today launched a comprehensive effort to accelerate ... through the application of genome analysis technologies, especially ... Cancer Genome Atlas (TCGA), will begin with a ...
Cached Biology News:Pretreating rogue cancer cells with aspirin cripples their resistance to targeted therapy 2Anyway you slice it, tomatoes cut through drought with new gene 2NIH launches comprehensive effort to explore cancer genomics 2NIH launches comprehensive effort to explore cancer genomics 3NIH launches comprehensive effort to explore cancer genomics 4
(Date:6/30/2015)... Florida (PRWEB) , ... June 30, 2015 , ... ... cannabis digital media company, launched “Cannavoices,” an unprecedented digital video and broadcast ... largest but also the most dynamic collection of legal medical cannabis stories ever ...
(Date:6/29/2015)... 30, 2015   Pharnext SAS today announced that ... the treatment of Charcot-Marie-Tooth Type 1A (CMT1A), is being presented ... Peripheral Nerve Society (PNS) Biennial Meeting at the Quebec Congress ... 27 - July 2, 2015. At Poster Viewing ... 1, 5p.m. to 7p.m. EDT: Poster 23: ...
(Date:6/29/2015)... ... June 29, 2015 , ... The global microfluidics market is ... period (2015 to 2020). The market is mainly driven by the rising geriatric ... R&D. However, lack of adequate healthcare and research infrastructure in emerging markets, dearth ...
(Date:6/29/2015)... WASHINGTON , June 29, 2015  AACC, ... to better health through laboratory medicine, is pleased ... journal, Clinical Chemistry , has increased to ... Reports. This increase places Clinical Chemistry ... and reflects the significant influence of the research ...
Breaking Biology Technology:Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3Pharnext's PXT-3003 Featured in Multiple Presentations at 2015 Peripheral Nerve Society Biennial Meeting 2Microfluidics Market Growing at 19.3% CAGR To 2020 – New research available at ReportsnReports.com 2Microfluidics Market Growing at 19.3% CAGR To 2020 – New research available at ReportsnReports.com 3Microfluidics Market Growing at 19.3% CAGR To 2020 – New research available at ReportsnReports.com 4Microfluidics Market Growing at 19.3% CAGR To 2020 – New research available at ReportsnReports.com 5AACC's Journal, Clinical Chemistry, Continues to Have Significant Impact on Medical Testing, Healthcare 2AACC's Journal, Clinical Chemistry, Continues to Have Significant Impact on Medical Testing, Healthcare 3