Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Immunogen: Peptide corresponding to amino acid residues from the N-terminal region of human thyroid hormone receptor, alpha1/alpha2-isotype. Storage: -20 C, Avoid Freeze/Thaw Cycles...
Antibodies were affinity purified using epitopes specific to QKI immobilized on solid support....
Direct ELISA Assay Diluent, 10 L...
SpectroQuest single beam 1.8nm UV/Vis spectrophotometer; stand-alone unit...
Biology Products:
(Date:5/24/2013)... noise in one French Quarter neighborhood of New Orleans ... ordinances, Annette Hurley, PhD, Assistant Professor of Audiology at ... a third-year LSUHSC doctor of audiology student, recommend that ... health. Their case study is published online in the ... ., "An important part of an audiologist,s practice is ...
(Date:5/23/2013)... honored more than 165 staff for their creation, ... annual Intellectual Property Commercialization Recognition & Rewards Program ... laboratory named materials scientist Jun Liu Inventor of ... that can store large amounts of energy, ease ... time it takes to charge cell phones, electric ...
(Date:5/23/2013)... the overall health, development, and academic success of ... ensuring that all students have opportunities to engage ... vigorous or moderate-intensity physical activity, says a new ... estimates suggest that only about half of school-age ... health and development. The report recommends that ...
Breaking Biology News(10 mins):Please do try this at home 2PNNL staff recognized for scientific accomplishments, moving technologies into the marketplace 2Schools should provide opportunities for 60 minutes of daily physical activity to all students 2Schools should provide opportunities for 60 minutes of daily physical activity to all students 3
... German . , In emerging countries such as ... consumption of red meat has quadrupled since 1961. The United ... lead to a doubling of global meat production by the ... limited farmland resources, will still be able to meet all ...
... DECEMBER 30, 2010 A recent study by a team ... incident of pathogens in biosolids over a 19 year period ... researchers also analyzed pathogen levels in biosolids at 18 wastewater ... analysis indicates pathogens levels have dropped since the implementation of ...
... you know that when you pick up a product promoted ... significant amount of this potentially harmful substance? An article by ... published in the January/February 2011 issue of the American ... can result in medically significant intake of harmful trans fat, ...
Cached Biology News:Eating low-fat, thanks to lupin proteins 2Wastewater treatment lowers pathogen levels 2Call for truth in trans fats labeling by the FDA 2
(Date:5/24/2013)... NJ (PRWEB) May 24, 2013 Dr. Ingrid ... NJ and Swedesboro, NJ, are proud to announce an Open ... will take place on Saturday, June 8th from 10 AM ... Warmuth, Anamaria Newport, MHS, PA-C and staff will be on ... fillers, laser and aesthetic treatments, and provide complimentary cosmetic consultations. ...
(Date:5/24/2013)... Senomyx , Inc. (NASDAQ: ... to discover, develop, and commercialize novel flavor ingredients, announced ... the Company,s Vice President, Biology and Gwen ... Communications, will present an overview of Senomyx,s technology and ... Time (7:25 a.m. Pacific Time) during the Citi 2013 ...
(Date:5/24/2013)... 24, 2013 Vestiage, Inc. (stock ... focused on science-based research and development, sales and ... and nutraceuticals, announced today that it is awarding ... the sale of Reluma Skin Illuminating Facial Care. ... application by sending an email to info(at)vestiageinc(dot)com and ...
(Date:5/23/2013)... Colo. , May 23, 2013 Venaxis, ... diagnostic company focused on obtaining FDA clearance and commercializing ... today announced the pricing of an underwritten public offering ... warrants to purchase 3,500,000 shares of its common stock ... a combined public offering price of $1.25 per share ...
Breaking Biology Technology:SENOMYX TO WEBCAST CORPORATE PRESENTATION AT THE CITI 2013 GLOBAL CONSUMER CONFERENCE 2Vestiage Announces Launch of Exclusive Territories for Reluma Brand Sales in USA 2Vestiage Announces Launch of Exclusive Territories for Reluma Brand Sales in USA 3Vestiage Announces Launch of Exclusive Territories for Reluma Brand Sales in USA 4Vestiage Announces Launch of Exclusive Territories for Reluma Brand Sales in USA 5Venaxis Announces Pricing of Offering of Common Stock and Warrants 2Venaxis Announces Pricing of Offering of Common Stock and Warrants 3