Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Allophycocyanin (APC) anti-human CD193 (CCR3, CKR3) 25 tests...
Mouse monoclonal [YLI-90] to Ly49I (Biotin) ( Abpromise for all tested applications)....
Goat polyclonal to PPP2R5D Immunogen: Peptide with sequence KRAEEFLTASQEAL, from C Terminus of the protein sequence according to NP_006236...
Rabbit polyclonal to KIAA1276 ( Abpromise for all tested applications). entrezGeneID: 27146 SwissProtID: Q9ULE4...
Biology Products:
(Date:1/22/2015)... 2015 /PRNewswire/ - Today, FindBiometrics, the leading source of biometrics industry ... new website design. "When we launched FindBiometrics 12 ... Peter O,Neill , founder and CEO of FindBiometrics. "Now it,s ... from the key players on a very broad scale.  We ...
(Date:1/22/2015)... MADISON, Wis. , Jan. 15, 2015  BellBrook ... for drug discovery, announced the launch of a ... of the company,s Transcreener UDP Assay, a high ... enzymes. The new assay will allow for sensitive ...
(Date:1/22/2015)... POINT ROBERTS, Washington , January 20, 2015 ... sectors including technology and tech stocks, releases video from the ... pickpocket and security consultant Apollo Robbins . ... about the Wocket™ biometric smart wallet, a product of NXT-ID, ...
Breaking Biology News(10 mins):Identity Industry Leading Publication Debuts New Look As Biometrics Hit Mainstream 2BellBrook Labs Launches a High Throughput Screening Assay for Glycosyltransferases with TR-FRET Readout 2Apollo Robbins Talks about the Illusion of Personal Safety and How Easily Your Wallet is Stolen; If a Wocket Wallet is Stolen the Thief Can't do Anything With it! 2Apollo Robbins Talks about the Illusion of Personal Safety and How Easily Your Wallet is Stolen; If a Wocket Wallet is Stolen the Thief Can't do Anything With it! 3
... State University researcher has demonstrated that a variety of environmental ... animal but the next three generations of its offspring. , ... the way genes turn on and offthe epigenetic effect studied ... on in the current issue of the online journal ...
... sizes. Scientists have discovered simple rules that control leaf shape during ... able to accurately emulate leaf growth from a bud. "A ... said lead author Samantha Fox from the John Innes Centre on ... bud, not flat with a pointed tip." By creating a ...
... On March 9, the New York Academy of Sciences ... of Established Regulatory Guidance." This full-day conference will explore ... challenges for follow-on versions of complex drugs. , On ... draft guidelines for implementing the Biologics Price Competition and ...
Cached Biology News:Effects of environmental toxicants reach down through generations 2First model of how buds grow into leaves 2Newly released FDA draft guidelines for biosimilar drugs to be discussed at conference 2
(Date:1/23/2015)...  Array BioPharma Inc. (NASDAQ: ARRY ) today ... Novartis Pharma AG to acquire worldwide rights to encorafenib ... This agreement is conditional on the closing of transactions announced ... which are expected to close in the first half ...
(Date:1/22/2015)...  Transwestern | RBJ today announces the firm brokered a long-term ... a leading biopharmaceutical company, at Two Ledgemont Center in ... Richards , president, and Brian Cohen , senior vice ... building at 95 Hayden Ave. Photo - ...
(Date:1/22/2015)... (PRWEB) January 22, 2015 The laboratory ... that has witnessed a number of technological advancements due ... regulatory requirements, growing need to integrate healthcare systems, and ... ease challenges in system integration. Key players in the ...
(Date:1/22/2015)... 22, 2015 zFlo Motion , a ... announce an exciting product from a new partner. STT-Systems ... over the past 15 years, with offerings in the optical-motion ... 3D IMU system (inertial measurement unit), iSen, is opening eyes ...
Breaking Biology Technology:Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 2Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 3Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 4Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 5Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 6Array Announces Agreement To Acquire ENCORAFENIB (LGX818) 7Transwestern | RBJ Advises Shire in 202,000 SF Lease, Creating Boston's Largest Suburban Biotech Campus 2Laboratory Information Management Systems Market is Expected to Reach $1,323.6 Million by 2019 - New Research Report by MarketsandMarkets 2Laboratory Information Management Systems Market is Expected to Reach $1,323.6 Million by 2019 - New Research Report by MarketsandMarkets 3Laboratory Information Management Systems Market is Expected to Reach $1,323.6 Million by 2019 - New Research Report by MarketsandMarkets 43D Motion Capture Just Got Easy 2