Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... compatible with ABI thermal cyclers, QPCR instruments ... characteristics can be sealed with heat ... Certified free of DNase, RNase and human ... Fisher Scientific, the world leader in serving ...
AVOID FREEZE/THAW CYCLES. Recognizes the ~32 kDa DNase IIα chain and the ~40 kDa proenzyme. DNase II causes both DNA condensation and DNA fragmentation. ...
BD BioCoat Vented Caps for 175 cm2 Flasks...
...
Biology Products:
(Date:4/17/2014)... Professor Luca Razzari of the nergie Matriaux Tlcommunications ... from the John R. Evans Leaders Fund of ... acquisition of state-of-the-art biotech and nanophotonics equipment. To ... the Ministre de l,Enseignement suprieur, de la Recherche, ... These new laboratories will help us develop new ...
(Date:4/17/2014)... in German . ... they also provide us with a continuous stream of information ... or sit still in a car the world glides ... retinas. Seemingly without effort, our brain calculates self-motion from this ... and a steady gaze during our own movements. Together with ...
(Date:4/17/2014)... about eight years ago, Katia Silvera , a postdoctoral ... were on a field trip in a mountainous area in ... never seen before. , Unable to identify it, they contacted ... turned out to be an unnamed species. So Carnevali recently ... "Lophiaris" is the genus name, comprising about 40 species in ...
Breaking Biology News(10 mins):New state-of-the-art biotech and nanotech equipment for INRS 2How vision makes sure that little fish do not get carried away 2How vision makes sure that little fish do not get carried away 3How vision makes sure that little fish do not get carried away 4Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... tool, Johns Hopkins scientists report that they have refined a ... sending them to exact locations at precise times. ... ever in manipulating single molecules, allowing them to see how ... to determine whether cells will grow, die, move or divide. ...
... Spanish . U.S. Department of Agriculture ... for methyl bromide are studying an alternative soil treatment that ... USDA,s Agricultural Research Service (ARS) are examining whether a cropping ... used to replace the popular fumigant. They also are studying ...
... cells and then clicking off the light makes the cells ... for chemotherapy drugs, as well as a non-invasive way to ... a report in ACS,s The Journal of Physical Chemistry ... colleagues note using this technique before to force cancer cells ...
Cached Biology News:Hopkins researchers use light to move molecules 2Alternatives eyed for methyl bromide 2
(Date:1/15/2014)... January 15, 2014 The Pittcon Organizing Committee ... Food Safety Tech , an e-Journal and producer of ... agreement for the second year for the co-location of Food ... The partnership provides that the registration fee to attend the ...
(Date:1/15/2014)... January 15, 2014 Look inside the ... items for the lab, from fluid handling to instruments ... to ship when you order. , Preferred Solutions ... , from the L/S® model for precise flow control ...
(Date:1/15/2014)... SAN JOSE, California , January 15, 2014 ... conjugates for cancer, today announced the appointment of Thomas C ... has over 20 years, development experience gained in the biotechnology ... "I am delighted to welcome Tom at this ...
(Date:1/15/2014)... 15, 2014 This webinar will focus ... clinical safety assessment in biosimilars. , Regulatory frameworks are ... drug development, however the complex nature of biopharmaceuticals makes ... and efficacy extremely challenging. Based on the specific aspects ...
Breaking Biology Technology:Pittcon Announces Second Year Partnership With Food Safety Tech 2Pittcon Announces Second Year Partnership With Food Safety Tech 3Cole-Parmer Begins 2014 with the Release of Preferred Solutions 2Oxford BioTherapeutics Appoints Thomas C Reynolds MD, PhD to its Board of Directors 2Oxford BioTherapeutics Appoints Thomas C Reynolds MD, PhD to its Board of Directors 3Xtalks Life Sciences Webinar Examines Safety Assessment of Biosimilars 2