Navigation Links
MasterAmp 10X PCR Enhancer from EPICENTRE Biotechnologies

ProductsMasterAmp 10X PCR Enhancer from EPICENTRE Biotechnologies
Company EPICENTRE Biotechnologies
Item MasterAmp 10X PCR Enhancer
Price $55.00
Description EPICENTREs patented MasterAmp™ 10X PCR Enhancer (with betaine) substantially improves PCR performance and allows improved sensitivity and specificity for amplification of many DNA templates. Using MasterAmp™ PCR Enhancer in PCR eliminates the base-pair composition dependence of DNA melting, increases enzyme?s thermal stability, suppresses pauses of DNA polymerase, and reduces secondary DNA structure. As a result, long DNA templates, difficult DNA templates (e.g., those with a high GC content), and those with other complex structures can be amplified at higher denaturing temperatures, significantly reducing the effect of secondary structure without loss of enzyme activity.
Info EPICENTRE BiotechnologiesEPICENTRE Biotechnologies
726 Post Road
Madison, WI 53713
USA
Customer Service: 800-284-8474
Tech Support: 800-284-8474
Fax Number: 608-442-6114
Web Site: http://www.epibio.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. MasterAmp 10X PCR Enhancer from EPICENTRE Biotechnologies
2. MasterAmp Taq DNA Polymerase Kit from EPICENTRE Biotechnologies
3. MasterAmp PCR Optimization Kit with (NH4)2SO4 from EPICENTRE Biotechnologies
4. MasterAmp PCR Optimization Kit without (NH4)2SO4 from EPICENTRE Biotechnologies
5. MasterAmp PCR Optimization Kit without (NH4)2SO4 from EPICENTRE Biotechnologies
6. MasterAmp Taq PCR Core Kit from EPICENTRE Biotechnologies
7. MasterAmp 2X PCR PreMix F without (NH4)2SO4 from EPICENTRE Biotechnologies
8. Polymer-Aide PCR Enhancer from Sigma-Aldrich
9. Can Get Signal Immunoreaction Enhancer Solution from Cosmo Bio Co., Ltd.
10. Qentix (tm) Western Blot Signal Enhancer from Pierce Biotechnology, Inc.
11. PCRX Enhancer System from Invitrogen
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2