Navigation Links
Goat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.

ProductsGoat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
Company Santa Cruz Biotechnology, Inc.
Item Goat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated
Price $238.00
Description RORgamma (S-14)
Info Santa Cruz Biotechnology, Inc.Santa Cruz Biotechnology, Inc.
2145 Delaware Avenue
Santa Cruz, California
95060
U.S.A.

Customer Service: 1-800-457-3801
Fax Number: 831-457-3801
Web Site: http://www.scbt.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
4. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
5. Mouse Anti-Human Procollagen type I C-terminal propeptide (PICP) Monoclonal Antibody, Unconjugated from AntibodyShop A/S
6. Mouse Anti-Human Acetylcholinesterase, brain (AChE) Monoclonal Antibody, Unconjugated, Clone 12B4 from AntibodyShop A/S
7. Mouse Anti-Human a1-Antitrypsin (alpha-1 AT) Monoclonal Antibody, Unconjugated, Clone 4E5 from AntibodyShop A/S
8. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
10. Mouse Anti-Human RAD51L3 Monoclonal Antibody, Unconjugated, Clone 1C8-3C11 from Novus Biologicals
11. Mouse Anti-Human BTAF1 Polyclonal Antibody, Unconjugated from Novus Biologicals
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... CLEVELAND , June 27, 2016  Global ... average 4.6 percent through 2020 to $7.2 billion.  ... (food and beverages, cleaning products, biofuel production, animal ... and biotechnology, diagnostics, and biocatalysts). Food and beverages ... gains driven by increasing consumption of products containing ...
(Date:6/27/2016)... ... 27, 2016 , ... Parallel 6 , the leading software as a ... Reach Virtual Patient Encounter CONSULT module which enables both audio and video telemedicine ... team. , Using the CONSULT module, patients and physicians can schedule a face to ...
(Date:6/27/2016)... 27, 2016   Ginkgo Bioworks , a leading ... was today awarded as one of the World ... world,s most innovative companies. Ginkgo Bioworks is engineering ... real world in the nutrition, health and consumer ... with customers including Fortune 500 companies to design ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita ... miRNAs in people with peritoneal or pleural mesothelioma. Their findings are the subject of ... now. , Diagnostic biomarkers are signposts in the blood, lung fluid or tissue ...
Breaking Biology Technology: