Navigation Links
Feline IL-2 ELISpot Development Kit from R&D Systems

ProductsFeline IL-2 ELISpot Development Kit from R&D Systems
Company R&D Systems
Item Feline IL-2 ELISpot Development Kit
Price $460.00
Description Request Info
Info R&D SystemsR&D Systems
R&D Systems, Inc.
614 McKinley Place N.E.
Minneapolis, MN 55413
Customer Service: 1 (800) 343-7475
1 (612) 379-2956

Fax Number: 1 (612) 656-4400
Web Site: http://www.rndsystems.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Feline IFN Alpha from PBL InterferonSource
2. Feline serum from Equitech-Bio
3. Feline GM-CSF ELISpot Kit from R&D Systems
4. Feline IL-2 ELISpot Kit from R&D Systems
5. Feline IFN-alpha, Unconjugated from R&D Systems
6. Feline GM-CSF ELISpot Development Kit from R&D Systems
7. Feline IL-10 ELISpot Development Kit from R&D Systems
8. Feline IFN-gamma ELISpot Development Kit from R&D Systems
9. Feline IL-2, Unconjugated from R&D Systems
10. Feline IL-5, Unconjugated from R&D Systems
11. Feline IL-12 / IL-23 p40, Unconjugated from R&D Systems
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... CLEVELAND , June 27, 2016  Global ... average 4.6 percent through 2020 to $7.2 billion.  ... (food and beverages, cleaning products, biofuel production, animal ... and biotechnology, diagnostics, and biocatalysts). Food and beverages ... gains driven by increasing consumption of products containing ...
(Date:6/27/2016)... ... 27, 2016 , ... Parallel 6 , the leading software as a ... Reach Virtual Patient Encounter CONSULT module which enables both audio and video telemedicine ... team. , Using the CONSULT module, patients and physicians can schedule a face to ...
(Date:6/27/2016)... 27, 2016   Ginkgo Bioworks , a leading ... was today awarded as one of the World ... world,s most innovative companies. Ginkgo Bioworks is engineering ... real world in the nutrition, health and consumer ... with customers including Fortune 500 companies to design ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita ... miRNAs in people with peritoneal or pleural mesothelioma. Their findings are the subject of ... now. , Diagnostic biomarkers are signposts in the blood, lung fluid or tissue ...
Breaking Biology Technology: