Navigation Links
EPA II Peroxidase Protection Buffer from CHEMICON

ProductsEPA II Peroxidase Protection Buffer from CHEMICON
Company CHEMICON
Item EPA II Peroxidase Protection Buffer
Price $89.00
Description EPA II Buffer is a diluent formulated to stabilize the activity of Chemicon horseradish peroxidase (HRP)-antibody conjugates at high conjugate dilution for extended periods.
Info CHEMICONCHEMICON
CHEMICON International, Inc.
28820 Single Oak Drive
Temecula, CA 92590
Customer Service: 800-437-7500
Tech Support: 800-437-7500
Fax Number: 800-437-7502
Web Site: http://www.chemicon.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Staphylococcus Enterotoxin A Polyclonal Antibody, Horseradish Peroxidase Conjugated from Abcam
2. Hydrogen Peroxide / Peroxidase Fluorometric (resorufin) Assay Kit, Fluoro H2O2 from BACHEM
3. Peroxidase, Horseradish, Conjugate-Stabilizing Solution from Calbiochem
4. EPA Peroxidase Prot.Buff from CHEMICON
5. SuperFreeze Peroxidase Conjugate Stabilizer from Pierce Biotechnology, Inc.
6. HistoMark Biotin-Streptavidin Peroxidase Kit, Rat Primary Antibody from KPL
7. HistoMark Biotin-Streptavidin Peroxidase Kit, Goat Primary Antibody from KPL
8. Rabbit Anti-Bovine Xanthine Oxidase, Buttermilk Polyclonal Antibody, Horseradish Peroxidase Conjugated from Meridian Life Science, Inc.
9. Horseradish Peroxidase (HRP) Conjugation Kit For labeling Antigens/Antibodies (Reaction Time 2 hr) from Alpha Diagnostic International Inc
10. Anti-Mouse IgGAM Polyclonal Antibody, Horseradish Peroxidase Conjugated from Invitrogen
11. Non-Protein Peroxidase Stabilizer from BioFX Laboratories, Inc.
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2