Navigation Links
ELISA, Microplate Coating from Affinity Life Sciences, Inc

ProductsELISA, Microplate Coating from Affinity Life Sciences, Inc
Company Affinity Life Sciences, Inc
Item ELISA, Microplate Coating
Price 
Description Affinity Life Sciences can provide custom microplate coating using advanced automated high throughput microplate processing equipment that dispenses and washes a variety of plate formats. We can also accommodate virtually any lot size of the following formats (with a volume range of 0.5-320 L):
  • 8 and 12 well strips
  • 96 well microplate
  • 384 well microplate
  • 1536 well microplate

The use of automated equipment provides a higher level of quality control during filling and washing procedures than manual or semi-manual microplate coating operations. Our quality control methods include validated microplate coating systems and the assurance that production runs will be accurate and reliable within lot and from lot-to-lot, which is essential for assays in drug discovery, toxicology, cell culture, research and clinical evaluations, diagnostic testing, and a host of other microplate studies that are critical to the end-user. These quality control measures will meet the strict demands of our medical device, biotechnology, pharmaceutical, and other life science customers.

Affinity Life Sciences can supply prepared microplates on a regularly scheduled basis for dependable delivery to your facility.

Info Affinity Life Sciences, IncAffinity Life Sciences, Inc
Milford Technology Center
528 Route 13 South
Suite 208
Milford, NH 03055
Customer Service: (603) 249-1644
Web Site: http://www.affinitylifesciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Bio-Stack Twister II Microplate Handler from BioTek Instruments
2. ELx50 Microplate Strip Washer from BioTek Instruments
3. Bio-Stack Microplate Stacker from BioTek Instruments
4. Precision XS Microplate Sample Processor from BioTek Instruments
5. Synergy HT Multi-Detection Microplate Reader from BioTek Instruments
6. NOVOstar Microplate Reader from BMG LABTECH
7. FLUOstar OPTIMA Multifunction Microplate Reader from BMG LABTECH
8. LUMIstar OPTIMA Microplate Reader from BMG LABTECH
9. Corning 96 Well Eia/Ria Microplate,Flat Bottom,Med Binding,Non-Sterile,W/O Lid from Sigma-Aldrich
10. Model 1575 Immunowash Microplate Washer from Bio-Rad
11. BD Falcon 1536-well Black/Clear Microplates from BD Biosciences - Discovery Labware
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products:
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2