Navigation Links
CopyRight pEZ BAC Blunt Cloning Kit (with electrocompetent cells) from Lucigen

ProductsCopyRight pEZ BAC Blunt Cloning Kit (with electrocompetent cells) from Lucigen
Company Lucigen
Item CopyRight pEZ BAC Blunt Cloning Kit (with electrocompetent cells)
Price $414.00
Description Error-free cloning of BAC (100+kb), fosmid (40kb), and large plasmid insert (10-20kb) DNAs. Greater insert stability than any othe BAC vector. On command 20-50 fold copy amplification for high yields and easy recombinant DNA purification. Available with blue-white screening (pEZ BAC) or transcription-free (pSMART VC) vectors for the highest insert stability. Kits include electrocompetent cells or no cells.
Info LucigenLucigen
Lucigen Corporation
2120 W. Greenview Drive
Middleton, WI 53562

Call Lucigen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-218-2672
Customer Service:
888-575-9695
608-831-9011

Fax Number:
608-831-9012
Web Site: http://www.lucigen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CopyRight pSMART VC BamHI Cloning Kit (without cells) from Lucigen
2. CopyRight pSMART VC Blunt Cloning Kit (with electrocompetent cells) from Lucigen
3. CopyRight pSMART VC Blunt Cloning Kit (without cells) from Lucigen
4. CopyRight pSMART VC BamHI Cloning Kit (with electrocompetent cells) from Lucigen
5. CopyRight pEZ BAC BamHI Cloning Kit (with electrocompetent cells) from Lucigen
6. CopyRight pEZ BAC Blunt Cloning Kit (without cells) from Lucigen
7. CopyRight pEZ BAC BamHI Cloning Kit (without cells) from Lucigen
8. Zero Blunt TOPO PCR Cloning Kit with One Shot TOP10 Chemically Competent E. coli from Invitrogen
9. Zero Blunt TOPO Kit for Sequencing with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli from Invitrogen
10. Zero Blunt TOPO PCR Cloning Kit with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli from Invitrogen
11. HTP Zero Blunt TOPO PCR Cloning Kit for Sequencing MultiShot StripWell E. coli from Invitrogen
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... CLEVELAND , June 27, 2016  Global ... average 4.6 percent through 2020 to $7.2 billion.  ... (food and beverages, cleaning products, biofuel production, animal ... and biotechnology, diagnostics, and biocatalysts). Food and beverages ... gains driven by increasing consumption of products containing ...
(Date:6/27/2016)... ... 27, 2016 , ... Parallel 6 , the leading software as a ... Reach Virtual Patient Encounter CONSULT module which enables both audio and video telemedicine ... team. , Using the CONSULT module, patients and physicians can schedule a face to ...
(Date:6/27/2016)... 27, 2016   Ginkgo Bioworks , a leading ... was today awarded as one of the World ... world,s most innovative companies. Ginkgo Bioworks is engineering ... real world in the nutrition, health and consumer ... with customers including Fortune 500 companies to design ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita ... miRNAs in people with peritoneal or pleural mesothelioma. Their findings are the subject of ... now. , Diagnostic biomarkers are signposts in the blood, lung fluid or tissue ...
Breaking Biology Technology: