Navigation Links
Concentrated Epitope Retrieval Buffer-Reduced pH from Bethyl Laboratories

ProductsConcentrated Epitope Retrieval Buffer-Reduced pH from Bethyl Laboratories
Company Bethyl Laboratories
Item Concentrated Epitope Retrieval Buffer-Reduced pH
Price $80.00
Description Bethyl Laboratories Epitope Retrieval Buffer-Reduced pH will unmask antigenic sites from formaldehyde fixation and allow for subsequent immunostaining.
Shelf-Life: 1 year from date of receipt
Info Bethyl LaboratoriesBethyl Laboratories
Bethyl Laboratories
P.O. Box 850
Montgomery, TX 77356
Customer Service: 800-338-9579
Fax Number: 936-597-6105
Web Site: http://www.bethyl.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Target Retrieval Solution, High pH, Concentrated x 10 from Dako
2. Epitope Peptide Microarray - Comprehensive Service from LC Sciences
3. Custom Epitope Peptide Microarray from LC Sciences
4. Rabbit Anti-RFP Epitope Tag Antibody, Unconjugated from ABR-Affinity BioReagents
5. PT ModuleTM Deparaffinization and Heat-Induced Epitope Retrieval Solution (100X) from Lab Vision
6. PT ModuleTM Deparaffinization and Heat-Induced Epitope Retrieval Solution (10X) from Lab Vision
7. IHC Select TE Buffer pH 9.0 [Antigen/ Epitope Retrieval Reagent], 10x from CHEMICON
8. Dako Target Retrieval Solution, pH 9 (x 10) from Dako
9. Dako Target Retrieval Solution, Citrate pH 6 (x 10) from Dako
10. Target Retrieval Solution, High pH from Dako
11. Microtiter Wells from Bethyl Laboratories
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... the immune system, a line of genetically engineered mice can ... of Medicine in St. Louis have found. , Scientists ... system component, a group of molecules known as the Major ... that is similar enough to step in and fill the ...
... to exist and even thrive in surroundings ranging from ... from the Weizmann Institute's Plant Sciences Department, led by ... just two amino acids (the building blocks of protein) ... temperatures and being adapted to living in extreme heat. ...
... has found that large segments of the Pacific Ocean ... the absence of the mineral stresses these microscopic ocean ... ocean productivity appear more robust than it really is. ... data may be inaccurate, the researchers say, and the ...
Cached Biology News:Mice lacking key immune component still control chronic viral infections 2Mice lacking key immune component still control chronic viral infections 3Bacteria beat the heat 2Iron critical to ocean productivity, carbon uptake 2Iron critical to ocean productivity, carbon uptake 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2