Navigation Links
Chicken Anti-Nucleobindin 1 (NUCB1) Antibody, Unconjugated from CHEMICON

ProductsChicken Anti-Nucleobindin 1 (NUCB1) Antibody, Unconjugated from CHEMICON
Company CHEMICON
Item Chicken Anti-Nucleobindin 1 (NUCB1) Antibody, Unconjugated
Price $330.00
Description Nucleobindin 1 [NUCB1]
Info CHEMICONCHEMICON
CHEMICON International, Inc.
28820 Single Oak Drive
Temecula, CA 92590
Customer Service: 800-437-7500
Tech Support: 800-437-7500
Fax Number: 800-437-7502
Web Site: http://www.chemicon.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Chicken Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
2. Chicken Anti-UCK2 Polyclonal Antibody, Unconjugated from Abcam
3. Chicken Anti-Corticoliberin Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
4. Chicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Rhodamine Conjugated from Biomeda Corporation
6. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Biotin Conjugated from Biomeda Corporation
7. Chicken Anti-Human Stomatin-like 2 (STOML2) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
8. Chicken Anti-Human DNA-directed RNA Polymerase II 7.6 Kd Polypeptide (POLR2L) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Chicken Anti-Polymerase (RNA) II (DNA directed) polypeptide L Antibody, Unconjugated from CHEMICON
10. Chicken Anti-Rab GDP dissociation inhibitor beta Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
11. Chicken Anti-Human Complement Component C4c Antibody, Unconjugated from CEDARLANE Laboratories Limited
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: