Navigation Links
Cell invasion Fluorometric (green) Assay Kit, InnoCyte™ from Calbiochem

ProductsCell invasion Fluorometric (green) Assay Kit, InnoCyte™ from Calbiochem
Company Calbiochem
Item Cell invasion Fluorometric (green) Assay Kit, InnoCyte™
Price $400.00
Description The InnoCyte Laminin-Based 96-well Cell Invasion Assay is designed to determine the invasive capacity of cells using laminin as a significant barrier to invasion or to screen potential anti-metastatic agents in vitro in a convenient, high-throughput, 96-well format. The 8 mm pore size is appropriate for all types of adherent cells such as epithelial, endothelial, or fibroblast cells. The assay is based on the Boyden-chamber principle. Each well of the 96-well cell culture insert contains a polycarbonate membrane with an 8 mm pore size that is coated with a laminin protein layer. The laminin layer forms an effective barrier that prevents non-invasive cells from passing through the 8 mm pores. Invasive cells that can degrade the laminin layer will migrate through the membrane and attach to the underside of the membrane. The invasive cells are dislodged from the underside of the cell culture insert and stained with a fluorescent dye in a single step. Fluorescence is determined using a fluorimeter with an excitation wavelength of ~485 nm and an emission wavelength of ~520 nm.
Info CalbiochemCalbiochem
Calbiochem, A Brand of EMD Biosciences, Inc.
10394 Pacific Center Court
San Diego, CA 92121
USA

Customer Service:
(800) 854-3417
(858) 450 9600

Tech Support: 800-628-8470
Fax Number:
(800) 776-0999
(858) 453 3552

Web Site: http://www.calbiochem.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Hydrogen Peroxide / Peroxidase Fluorometric (resorufin) Assay Kit, Fluoro H2O2 from BACHEM
2. 20S Proteasome Fluorometric (AMC) Assay Kit from CHEMICON
3. Telomerase Fluorometric Assay Kit, TRAPeze from CHEMICON
4. Pyrophosphate Fluorometric (Blue) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
5. TACE Fluorometric (MCA)) Assay Kit, InnoZyme™ from Calbiochem
6. Lysozyme Fluorometric (Green) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
7. Amylase Fluorometric (Green) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
8. Amylase Fluorometric (Green) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
9. Cholesterol Fluorometric (Red) Assay Kit, Amplex Red from Molecular Probes (Invitrogen)
10. Pyrophosphate Fluorometric (Blue) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
11. MMP-1 Fluorometric (Blue) Assay Kit, EnzoLyte from AnaSpec
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2