Navigation Links
CapSure HS LCM Caps Starter Pack with Alignment Tray, Incubation Block, 24 ExtracSure devices and 12 PrepStrips from Arcturus, now part of Molecular Devices

ProductsCapSure HS LCM Caps Starter Pack with Alignment Tray, Incubation Block, 24 ExtracSure devices and 12 PrepStrips from Arcturus, now part of Molecular Devices
Company Arcturus, now part of Molecular Devices
Item CapSure HS LCM Caps Starter Pack with Alignment Tray, Incubation Block, 24 ExtracSure devices and 12 PrepStrips
Price 
Description Precision-designed for Optimal Microdissection

CapSure HS and CapSure Macro LCM Caps enable the precise and rapid extraction of populations of pure cells from tissue sections and cytology samples with Laser Capture Microdissection.

Ensure the Integrity of Microdissected Cells for Downstream Molecular Analysis

All CapSure LCM Caps have a patented transfer film bonded to the lower cap surface. Using the PixCell, AutoPix or Veritas Microdissection Systems, an infrared laser pulses through the top of the cap during LCM and interacts with the transfer film, which then melts and bonds to the cells or regions of interest. The film absorbs the laser radiationinstead of the tissue or cell samplecreating a gentle, non-damaging microdissection that preserves the integrity of the captured material.

Optimize Capture to Meet Your Specific Application Needs

Depending on your application, either the CapSure HS or CapSure Macro Caps will provide you with the best samples for analysis.

Extract Small Numbers of Cells with High Sensitivity

CapSure HS LCM Caps enable the highly sensitive extraction and detection of biological molecules from small numbers of cells.

CapSure HS LCM Caps contain ridges at the bottom that keep the active capture area of the cap twelve microns off the surface of the sample. This separation ensures the precise capture of up to several hundreds of cells.

In addition, the CapSure LCM Caps work with ExtracSure devices that minimize the dilution of biological molecules extracted from captured cells. This optimizes the recovery of these molecules for downstream molecular analysis.

Info Arcturus, now part of Molecular DevicesArcturus, now part of Molecular Devices
400 Logue Avenue
Mountain View, CA 94043, USA
Customer Service: 650.962.3020
Fax Number: 650.962.3039
Web Site: http://www.arctur.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CapSure HS LCM Caps - Bulk Pack (Alignment Tray and Incubation Block required, not included) from Arcturus, now part of Molecular Devices
2. CapSure Macro LCM Caps from Arcturus, now part of Molecular Devices
3. CapSure Macro LCM Caps - Bulk Pack from Arcturus, now part of Molecular Devices
4. CapSure HS LCM Caps with 32 ExtracSure devices and 12 PrepStrips (Alignment Tray and Incubation Block required, not included) from Arcturus, now part of Molecular Devices
5. Silencer siRNA Starter Kit from Ambion
6. SYBR Safe DNA Gel Stain Starter Kit - with 1 L of SYBR Safe DNA gel stain in 0.5X TBE (S33100) and one photographic filter (S37100) from Molecular Probes (Invitrogen)
7. StemSep Hu-Mu Chimera Starter Kit, Kit from StemCell Technologies, Inc.
8. EasySep PE Selection Kit, Other, Starter Kit from StemCell Technologies, Inc.
9. EasySep Neg Mouse Combo Starter Kit from StemCell Technologies, Inc.
10. EasySep Mouse Combo Starter, Kit from StemCell Technologies, Inc.
11. Agencourt AMPure 384 Starter Kit from Agencourt Bioscience
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products:
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2