Navigation Links
CEQ 8800 Genetic Analysis System from Beckman Coulter

ProductsCEQ 8800 Genetic Analysis System from Beckman Coulter
Company Beckman Coulter
Item CEQ 8800 Genetic Analysis System
Price 
Description The CEQ 8800 Genetic Analysis System, which processes two 96-well plates and tracks the samples. This automated system adds a higher level of throughput to the CEQ product line. The CEQ 8800, part of Beckman Coulters new GenomeLab family of products*, also offers a bar coding link with the Biomek series liquid handers, for increased automation.

The CEQ 8800 automates and integrates the majority of genetic analysis functions into one flexible, easy-to-use system that adapts to changes in sample type and complexity. With one gel, one array and one software platform, users can perform DNA sequencing, heterozygote detection, confirmatory sequencing, mutation analysis, allele identification, SNP (single nucleotide polymorphism) scoring, microsatellite instability and amplified fragment length polymorphism fingerprinting. To ensure accurate sample tracking, CEQ 8800 sample set-up can be created at the initial sample preparation stage on the Biomek series liquid handlers. The CEQs integrated bar code reader automatically calls up and programs the method, for time savings and reduced handling errors.

*GenomeLab is a new family of genetic analysis tools from Beckman Coulter that innovate, simplify and automate genomics processes to enable identification of new markers of biological, diagnostic and therapeutic interest. GenomeLab solutions help researchers identify the differences between normal and diseased states, isolate and purify samples, prepare nucleic acids, analyze and evaluate genetic material. GenomeLab tools will be used in the validation of biomarkers and their association with specific disease states as well as in the evaluation of drug efficacy, and may lead to a new generation of standardized diagnostic tests with the promise of delivering personalized medicine.

Info Beckman CoulterBeckman Coulter
4300 N. Harbor Boulevard
PO Box 3100
Fullerton, CA 92834-3100
U.S.A.
Customer Service: (800) 742-2345
Fax Number: (800) 643-4366
Web Site: http://www.beckmancoulter.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CEQ 8000 Genetic Analysis System from Beckman Coulter
2. GenomeLab GeXP Genetic Analysis System from Beckman Coulter
3. CEQ 8000 Genetic Analysis System from Beckman Coulter
4. CEQ 8000 Genetic Analysis System from Beckman Coulter
5. Human Genetic Cell Bank Service from European Collection of Cell Cultures (ECACC)
6. Mutation Surveyor from SoftGenetics, LLC.
7. GeneMarker from SoftGenetics, LLC.
8. Genetic Mapping of Disease Genes from Promega
9. GIBCO Geneticin Selective Antibiotic liquid from Invitrogen
10. Mutation Explorer from SoftGenetics, LLC.
11. GenePix Pro Microarray Image Analysis Software from Molecular Devices
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2