Navigation Links
BD Falcon Roller Bottle, smooth surface from BD Biosciences - Discovery Labware

ProductsBD Falcon Roller Bottle, smooth surface from BD Biosciences - Discovery Labware
Company BD Biosciences - Discovery Labware
Item BD Falcon Roller Bottle, smooth surface
Price 
Description BD Falcon 850 cm Smooth-surface TufRol Roller Bottle, tissue-culture treated polystyrene, blow-molded one-piece design, with easy on/off non-vented cap, packed in double bag. (20/ca)

  • Packaging: 20 / double pack, 20 / case
Info BD Biosciences - Discovery LabwareBD Biosciences - Discovery Labware
BD Biosciences - Discovery Labware
Two Oak Park Dr.
Bedford, MA 01730-9902
Customer Service: 800.343.2035
Fax Number: 800.743.6200
Web Site: http://www.bd.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. BD Falcon Roller Bottle, smooth surface from BD Biosciences - Discovery Labware
2. 801 Rotor System with 305/315, 6 50 ml Falcon/Corning from Thermo Scientific
3. 809 Rotor System with 302/668, 12 15 ml Falcon/Corning from Thermo Scientific
4. BD Falcon 96-well Flat-bottom ELISA Plates from BD Biosciences - Discovery Labware
5. BD Falcon 1536-well Black/Clear Microplates from BD Biosciences - Discovery Labware
6. BD Falcon 1536-well Black Microplates from BD Biosciences - Discovery Labware
7. BD Falcon Standard Cell Culture Dish from BD Biosciences - Discovery Labware
8. BD Falcon Center-well Organ Culture Dish, In Vitro Fertilization Dish from BD Biosciences - Discovery Labware
9. BD Falcon 96-square well Insert System angled-bottom plate and lid from BD Biosciences - Discovery Labware
10. BD Falcon Easy Grip Cell Culture Dish from BD Biosciences - Discovery Labware
11. BD Falcon Gridded Cell Culture Dish (20 mm molded in base) from BD Biosciences - Discovery Labware
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... The empty capsules market is experiencing ... and technological innovations in the empty capsules market. ... the growth of the empty capsules market. , ... Scope of Report , The report will enrich ... firms to gauge the pulse of the market ...
(Date:12/19/2014)... -- Relmada Therapeutics, Inc. (OTCQB: RLMD), a clinical-stage company ... announced the results of its annual general meeting of ... year in Relmada,s history and it set the stage ... Sergio Traversa , chief executive officer of Relmada. "Over ... human resource and clinical development objectives that position Relmada ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
(Date:12/17/2014)... Audacity, a leading California-based health and ... the Huntsworth Health Group, is proud to announce the ... her role, Gonzales will serve as Senior Vice President ... to welcome a talent of Jamie’s caliber to the ... “She is a proven healthcare innovation leader and brand ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2