Navigation Links
BD BioCoat Matrigel Matrix 35 mm Culture Dishes from BD Biosciences - Discovery Labware

ProductsBD BioCoat Matrigel Matrix 35 mm Culture Dishes from BD Biosciences - Discovery Labware
Company BD Biosciences - Discovery Labware
Item BD BioCoat Matrigel Matrix 35 mm Culture Dishes
Price 
Description BD BioCoat Matrigel Matrix 35 mm Culture Dishes

Coating : BD MatrigelTM Basement Membrane Matrix
Surface : ECM/attachment factors
Surface area : 9.6 cm2
Dim nominal : 35 mm x 10 mm
Vol working : 2.5-3.0 ml

Info BD Biosciences - Discovery LabwareBD Biosciences - Discovery Labware
BD Biosciences - Discovery Labware
Two Oak Park Dr.
Bedford, MA 01730-9902
Customer Service: 800.343.2035
Fax Number: 800.743.6200
Web Site: http://www.bd.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. BD BioCoat Osteologic 12 mm round Coverslips from BD Biosciences - Discovery Labware
2. BD BioCoat Gelatin 100 mm Culture Dishes from BD Biosciences - Discovery Labware
3. BD BioCoat Laminin 100 mm Culture Dishes from BD Biosciences - Discovery Labware
4. BD BioCoat Poly-D-Lysine/Laminin 100 mm Culture Dishes from BD Biosciences - Discovery Labware
5. BD BioCoat Gelatin 100 mm Culture Dishes from BD Biosciences - Discovery Labware
6. BD BioCoat Collagen I 60 mm Culture Dishes from BD Biosciences - Discovery Labware
7. BD BioCoat Poly-D-Lysine 60 mm Culture Dishes from BD Biosciences - Discovery Labware
8. BD BioCoat Vented Caps for 175 cm2 Flasks from BD Biosciences - Discovery Labware
9. BD BioCoat Laminin 150 mm Culture Dishes from BD Biosciences - Discovery Labware
10. BD BioCoat Collagen IV 150 mm Culture Dishes from BD Biosciences - Discovery Labware
11. BD BioCoat Fibronectin 150 mm Culture Dishes from BD Biosciences - Discovery Labware
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:5/12/2016)... May 12, 2016 WearablesResearch.com , a ... the overview results from the Q1 wave of its ... wave was consumers, receptivity to a program where they ... a health insurance company. "We were surprised ... says Michael LaColla , CEO of Troubadour Research, ...
(Date:4/26/2016)... LONDON , April 26, 2016 /PRNewswire/ ... Systems, a product subsidiary of Infosys (NYSE: ... partnership to integrate the Onegini mobile security platform ... http://photos.prnewswire.com/prnh/20151104/283829LOGO ) The integration ... security to access and transact across channels. Using ...
(Date:4/14/2016)... Israel , April 14, 2016 ... Authentication and Malware Detection, today announced the appointment of ... assumed the new role. Goldwerger,s leadership appointment ... on the heels of the deployment of its platform ... BioCatch,s behavioral biometric technology, which discerns unique cognitive and ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... CLEVELAND , June 27, 2016  Global ... average 4.6 percent through 2020 to $7.2 billion.  ... (food and beverages, cleaning products, biofuel production, animal ... and biotechnology, diagnostics, and biocatalysts). Food and beverages ... gains driven by increasing consumption of products containing ...
(Date:6/27/2016)... ... 27, 2016 , ... Parallel 6 , the leading software as a ... Reach Virtual Patient Encounter CONSULT module which enables both audio and video telemedicine ... team. , Using the CONSULT module, patients and physicians can schedule a face to ...
(Date:6/27/2016)... 27, 2016   Ginkgo Bioworks , a leading ... was today awarded as one of the World ... world,s most innovative companies. Ginkgo Bioworks is engineering ... real world in the nutrition, health and consumer ... with customers including Fortune 500 companies to design ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita ... miRNAs in people with peritoneal or pleural mesothelioma. Their findings are the subject of ... now. , Diagnostic biomarkers are signposts in the blood, lung fluid or tissue ...
Breaking Biology Technology: