Navigation Links
Anti-P-selectin Glycoprotein Ligand-1 (PSGL-1) Monoclonal Antibody, Unconjugated, Clone KPL-1 from CHEMICON

ProductsAnti-P-selectin Glycoprotein Ligand-1 (PSGL-1) Monoclonal Antibody, Unconjugated, Clone KPL-1 from CHEMICON
Company CHEMICON
Item Anti-P-selectin Glycoprotein Ligand-1 (PSGL-1) Monoclonal Antibody, Unconjugated, Clone KPL-1
Price $230.00
Description Interactions between P-selectin and P-selectin glycoprotein ligand-1 (PSGL-1) mediate the earliest rolling of leukocytes on the lumenal surface of endothelial cells at sites of inflammation. To date, the primary role of PSGL-1 in mediating the interaction between neutrophils and P-selectin has been well documented.MAB4092 completely blocks recognition of PSGL-1 by either P-selectin or by L-selectin, but does not affect leukocyte recognition of E-selectin. Two color flow cytometry of normal leukocytes has demonstrated that PSGL-1 is expressed on essentially all blood neutrophils, NK cells, blood cells, T cells, and monocytes, but PSGL-1 stains B cells at significantly lower levels than other cell types. Variation in tyrosine sulfation during B cell differentiation may affect the stability of B cells to interact with P- and L-selectin.
Info CHEMICONCHEMICON
CHEMICON International, Inc.
28820 Single Oak Drive
Temecula, CA 92590
Customer Service: 800-437-7500
Tech Support: 800-437-7500
Fax Number: 800-437-7502
Web Site: http://www.chemicon.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-HSV-2 Glycoprotein G-2 Monoclonal Antibody, Unconjugated, Clone H1206 from Meridian Life Science, Inc.
2. Glycoprotein Isolation Kit WGA from Pierce Biotechnology, Inc.
3. Goat Anti-Human Alpha 1 Acid Glycoprotein Polyclonal Antibody, Unconjugated from Immunology Consultants Laboratory, Inc.
4. Mouse Anti-Secretory Component Glycoprotein Monoclonal Antibody, Unconjugated, Clone SPM217 from Abcam
5. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
6. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
7. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
8. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
9. Anti-S-100 protein, ab heterodimer Monoclonal Antibody, Unconjugated from HyTest Ltd.
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
(Date:6/16/2016)... 2016 The global ... reach USD 1.83 billion by 2024, according to ... Technological proliferation and increasing demand in commercial buildings, ... drive the market growth.      (Logo: ... development of advanced multimodal techniques for biometric authentication ...
(Date:6/7/2016)... TORONTO , June 7, 2016  Syngrafii ... begun a business relationship that includes integrating Syngrafii,s ... pilot branch project. This collaboration will result in ... for the credit union, while maintaining existing document ... http://photos.prnewswire.com/prnh/20160606/375871LOGO ...
(Date:6/2/2016)... , June 2, 2016 Perimeter ... Platforms, Unmanned Systems, Physical Infrastructure, Support & Other Service  ... visiongain offers comprehensive analysis of the global ... market will generate revenues of $17.98 billion in 2016. ... DVTEL Inc, a leader in software and hardware technologies ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... June 24, 2016  Regular discussions on a range of ... between the two entities said Poloz. Speaking at ... Ottawa , he pointed to the country,s inflation target, ... government. "In certain ... institutions have common economic goals, why not sit down and ...
(Date:6/24/2016)... ... June 24, 2016 , ... Researchers at the Universita Politecnica delle Marche in ... peritoneal or pleural mesothelioma. Their findings are the subject of a new article on ... biomarkers are signposts in the blood, lung fluid or tissue of mesothelioma patients that ...
(Date:6/23/2016)... 23, 2016   Boston Biomedical , an ... designed to target cancer stemness pathways, announced that ... Orphan Drug Designation from the U.S. Food and ... cancer, including gastroesophageal junction (GEJ) cancer. Napabucasin is ... inhibit cancer stemness pathways by targeting STAT3, and ...
(Date:6/23/2016)... , June 23, 2016 Houston Methodist ... the Cy-Fair Sports Association to serve as their ... agreement, Houston Methodist Willowbrook will provide sponsorship support, ... connectivity with association coaches, volunteers, athletes and families. ... the Cy-Fair Sports Association and to bring Houston ...
Breaking Biology Technology: