Navigation Links
Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics

A team of scientists led by biophysicist Stuart Lindsay from the Biodesign Institute at Arizona State University has created the first reproducible single molecule negative differential resistor ?and in the process has developed a groundbreaking experimental technique that provides a “roadmap?for designing single-molecule devices based on biochemistry.

The findings were presented Feb. 18 by Lindsay at the American Association for the Advancement of Science annual meeting in Washington , D.C. , in a session titled “Frontiers in Bioinspired Materials and Nanosystems.?The findings also will be reported in a forthcoming edition of the American Chemical Society’s journal Nano Letters.

Lindsay’s team reports achieving an experimental result that physicists have been trying to detect for a long time: negative differential resistance in a single molecule attached to electrodes.

The specifically designed molecule, a hepta-aniline oglimer, belongs to a group of molecules that biochemists believe to be capable of being molecular switches but that have failed to exhibit those properties in conductance experiments. The team solved the problem by developing a technique where the molecule could be tested in an electrolyte solution, a condition that past experiments didn’t attempt because of the problem of interaction between the solution and the electrodes.

“Almost everything we know about charge transfer in molecules is based on measurements made with the molecules suspended in solution,?Lindsay says. “Chemists have understood for a while that the solvent itself plays a major part in charge transfer processes ?the ions in the solution are necessary to make the process happen. Yet almost every ‘molecular electronic?measurement made to date has been made in a vacuum or other conditions that suppress solvent-mediated events. It’s no wonder that we could not get reliable results.?/p>

Though numerous molecules have been identified as targets for use
'"/>

Source:Arizona State University


Page: 1 2 3

Related biology news :

1. Visceral Leishmaniasis: Successful Vaccine Trial In Dogs
2. Penn Surgeons Use Completely Robotic Surgery to Successfully Treat Prostate Cancer
3. Successful cell engineering may lead to mad cow prevention, say researchers
4. Successful transplantation from pig embryos to mice
5. Successful lung cancer surgery not enough to break nicotine dependence in many smokers
6. Novel Asthma Study Shows Multiple Genetic Input Required; Single-gene Solution Shot Down
7. Single stem cells from bone heal a broken heart
8. Single-donor Islet Transplantation Procedure Shows Promise For Patients With Type 1 Diabetes
9. Single gene is genetic switch for fly sexual behavior
10. Single microRNA causes cancer in transgenic mouse
11. Single cell amoeba increases MRSA numbers 1000- fold
Post Your Comments:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: