Navigation Links
Mutant mouse provides insights into breast cancer

By discovering a mutant mouse that is highly susceptible to mammary tumors, Cornell researchers have found a novel potential link between genetic defects in DNA replication (copying) and breast cancer.

The mouse contains a mutation in a gene essential for replicating DNA in both humans and mice that increases the rate of flawed copies of genetic material, leading to mouse breast cancers.

In a paper published in Nature Genetics online (and upcoming in the Dec. 27 print issue), the Cornell geneticists report that by extensively testing hundreds of mice pedigrees, they found a mutant line of mice called Chaos3 that had a 20-fold increase in a hallmark for cancer called genomic instability -- a blanket term for an elevation in the number of mutations, chromosomal aberrations or loss of integrity of genetic information that occur when DNA replicates. While the Chaos3 mice appear normal in every way, the females are highly predisposed to mammary tumors.

"It's known that most cancers, by the time you look at them, have genomic instability in some form or another," said John Schimenti, a genetics professor in Cornell's Departments of Biomedical Sciences, and Molecular Biology and Genetics and the paper's senior author. "Our research demonstrated that genomic instability is probably leading to these cancers."

Schimenti and colleagues found that in the Chaos3 mice, the DNA codings in a gene called Mcm4 were partially impaired. The Mcm4 gene is one of six related Mcm genes that play essential roles in replication and were originally discovered at Cornell in baker's yeast (S. cerevisiae). The genes have remained largely unchanged throughout evolution and are evident in archaebacteria, yeast, mammals and more. It is unknown why the impaired Mcm4 genes in the Chaos3 mice led exclusively to breast cancer, Schimenti said.

Mcm4 is essential for DNA replication and thus cell growth, according to Schimenti. Partially impaired Mcm4 gene
'"/>

Source:Cornell University News Service


Page: 1 2

Related biology news :

1. Mutant mice show key autism traits
2. Mutant gene causes severe kidney disease in infants
3. Man and mouse share genome structures
4. Genome-wide mouse study yields link to human leukemia
5. Report that delayed motherhood decreases life expectancy of mouse offspring
6. Agilent Technologies introduces advanced zebrafish, mouse microarrays for stem cell and developmental biology research
7. Stem cells in bone marrow replenish mouse ovaries
8. Mosaic mouse technique offers a powerful new tool to study diseases and genetics
9. Researchers extend mouse lifespan by protecting against free radicals
10. Gene therapy advance treats hemophilia in mouse models
11. Targeting a key enzyme with gene therapy reversed course of Alzheimers disease in mouse models
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Mutant mouse provides insights into breast cancer

(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: