Navigation Links
Wiley launches new interdisciplinary review WIREs Energy and Environment
Date:8/1/2012

Hoboken, NJAugust 1, 2012John Wiley & Sons, Inc., today announced the launch of a new interdisciplinary review publication, WIREs Energy and Environment, publishing online this month.

The broad scope of energy research demands collaboration between different disciplines of science and technology, and strong interaction between engineering, physical and life scientists, economists, sociologists and policy-makers.

WIREs Energy and Environment is part of Wiley Interdisciplinary Reviews (WIREs), unique hybrids of encyclopedias and journals which emphasize the importance of interdisciplinary collaboration in research and education. The publication will provide a much-needed authoritative resource addressing key topics spanning bioenergy, conventional energy and fuels, energy and climate, energy and materials, energy efficiency, energy innovations, energy planning, energy sustainability, energy systems, fuel cells and hydrogen, solar energy, and wind power.

WIREs Energy and Environment is edited by Peter Lund, Aalto University, Finland, and John Byrne, Center for Energy and Environmental Policy, University of Delaware.

"Understanding the essence of energy and its numerous connections to society and the environment requires viewing it from many perspectives," say Lund and Byrne. "Multidisciplinary thinking will be of the utmost importance in coming decades in evolving from a fossil fuel-based to low-carbon economy to find the best and optimal solutions for the society as a whole."

A key contributor to the inaugural issue of WIREs Energy and Environment is Nobel Laureate Dr. Rajendra Pachauri. In his article 'The Way Forward in Climate Change Mitigation' Dr. Pachauri advocates greater involvement by not-for-profit organizations and development agencies in promoting sustainable energy use.

"Transforming scientific discoveries into practical solutions requires the integration of di
'/>"/>

Contact: Amy Molnar
sciencenewsroom@wiley.com
Wiley
Source:Eurekalert

Page: 1 2

Related biology news :

1. WileyChina.com - Now Featuring Bespoke Pages for China’s Life Scientists
2. Wiley-Blackwell launches new open-access journal: Food Science & Nutrition
3. LABS, Inc. Launches Suite of Next-Generation Test Offerings; Focuses on Expanding Complex Biologic Testing Portfolio in 2012
4. Elsevier launches new journal Algal Research
5. Clinical trial launches to see whether vitamin D helps treat multiple sclerosis
6. Thomson Reuters Launches Life Sciences Partner Ecosystem to Drive Collaborative R&D Drug Processes
7. WanderID Launches Breakthrough ID Product for Children, Seniors
8. MindSpec launches online Autism Reading Room
9. NineSigma Launches NineSights, the Worlds First Open Innovation Social Media Destination for Innovation Seekers and Solution Providers
10. PuraMed BioScience®, Inc., Launches a Marketing Blitz for LipiGesic® M, Its Clinically-Tested Migraine Pain Reliever in the Denver, CO Region to Coincide with the NACDSs Marketplace 2012 Trade Convention
11. NIST launches new website to educate industry about alternatives to mercury thermometers
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: