Navigation Links
Wiley announces increase in Impact Factors
Date:7/1/2013

recently launched open access journal Ecology and Evolution at 1.184.

There were also strong performances for Annals of the New York Academy of Sciences (4.375), FEMS Microbiology Reviews which rose from 10.960 to 13.231, Human Brain Mapping (6.878) and Reviews of Geophysics, published on behalf of the American Geophysical Union (AGU), which increased to 13.906 and ranks number two in Geochemistry & Geophysics.

Microbial Biotechnology, which recently moved to an open access model, achieved its second IF rising from 2.534 to 3.214. It went up 14 places in the Microbiology category to 38/116, and 21 places in the Biotechnology & Applied Microbiology category to 41/159.

Highlights in Health Sciences:

This year 329 Wiley health science journals featured in the JCR, including eight number one ranking journals and overall 62 journals which appear in the top ten of a subject category. Three titles have been indexed for the first time and received their first IF.

The number one ranked journals are CA -- A Cancer Journal for Clinicians (153.459/Oncology), American Journal of Transplantation, (6.192/Transplantation), Addiction Biology (5.914/Substance Abuse), Addiction (4.577/Substance Abuse Social Science), Periodontology 2000 (4.012/Dentistry, Oral Surgery & Medicine), International Journal of Andrology (3.565/Andrology), Medical Education (3.546/Education, Scientific Disciplines) and BIRTH: Issues in Perinatal Care (2.926/Nursing, in both Science and Social Science JCRs).

Wiley now publishes the top three journals in the Substance Abuse Science category: Addiction Biology, Addiction, and Alcoholism: Clinical and Experimental Research.

British Journal of Pharmacology was awarded an Impact Factor of 5.067 making it the leading general pharmacology research
'/>"/>

Contact: Jennifer Beal
sciencenewsroom@wiley.com
44-012-437-70633
Wiley
Source:Eurekalert

Page: 1 2 3 4 5 6

Related biology news :

1. 2013 Wiley Prize to be awarded at Apr. 5 event
2. The Scandinavian Plant Physiology Society and Wiley extend over 60 years of partnership
3. 66 titles join Wileys journal portfolio in 2013
4. Over 12,000 Wiley Online Books made available in developing countries via Research4Life
5. Wiley makes scientific PDFs interactive with the ReadCube Web Reader from Labtiva
6. 12th annual Wiley Prize in Biomedical Sciences awarded
7. Wiley Prize in Biomedical Sciences awarded to Rosbash, Hall and Young
8. Physiological societies partner with Wiley on new open access journal
9. Wiley Partners with TED
10. British Ecological Society partners with Wiley open access journal Ecology and Evolution
11. Wiley signs collaboration agreement with the Asian Federation of Biotechnology
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... BURLINGTON, Mass. , Dec. 18, 2014  Decision ... dental biomaterial market will grow moderately through ... implant procedures and growing awareness of dental biomaterials all ... underdeveloped markets such as China ... incomes will bring dental procedures within reach for a ...
(Date:12/17/2014)... December 17, 2014 Based on ... overall surgical imaging market is dominated by four ... surgical imaging market. These players include GE Healthcare ... Imaging (Germany). , Full Report Copy at ... GE Healthcare can be attributed to its strong ...
(Date:12/17/2014)... This report is a professional ... For an overview analysis, the report introduces quartz ... structure, industry overview, policy analysis, and news analysis, ... has witnessed rapid development with key manufacturers increasing ... report mentions quartz tubing upstream raw materials and ...
(Date:12/17/2014)... 2014  United Therapeutics Corporation (NASDAQ: UTHR ... as changes to Martine Rothblatt , Ph.D,s compensation ... United Therapeutics announced the promotion of Roger ... and David Zaccardelli , Pharm.D. to Executive Vice ... promotions, Dr. Rothblatt,s title will change from Chairman and ...
Breaking Biology Technology:Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 2Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 42020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2United Therapeutics Corporation Announces Executive Promotions and CEO Compensation Change 2United Therapeutics Corporation Announces Executive Promotions and CEO Compensation Change 3United Therapeutics Corporation Announces Executive Promotions and CEO Compensation Change 4
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: