Navigation Links
Wiley announces increase in Impact Factors
Date:7/1/2013

Hoboken, N.J. -- John Wiley & Sons, Inc., today announced a continued increase in the proportion of its journal titles indexed in the Thomson Reuters 2012 Journal Citation Reports (JCR), with 1,192 (approximately 77%) titles now indexed, up from 1,156 in the 2011 JCR. Wiley titles now account for the largest share of journals in 50 categories.

In the 2012 JCR the number of Wiley journals with a top category rank increased by 19% (4) and the number of Wiley titles indexed in the top ten of their categories also increased by 11% (27). Of publishers with more than 100 journals indexed in the 2012 JCR, Wiley saw the largest proportion of titles (close to 60%) increasing in Impact Factor (IF).

Highlights:

  • 1,192 Wiley journals now have an IF.
  • 25 Wiley journals achieved a top category rank across 31 JCR categories, up from 21 in 2011.
  • 264 Wiley journals achieved a top 10 category rank across 341 categories, up from 237 in 2011.
  • 59.4% of Wiley journals increased their IF.
  • Wiley titles appear in 218 of the 232 subject categories.
  • Wiley journals make up the largest share of journals in 50 categories.
  • CA -- A Cancer Journal for Clinicians, a Wiley published journal, continues to have the highest IF in the JCR.

"We are honoured to work with the editors, societies, and publishing teams behind such high quality publications, and it gives us great pleasure to see the portfolio go from strength to strength. All those involved, our colleagues and our partners, should be delighted by the latest JCR results," said Steven Miron, Senior Vice President in Wiley's Global Research business.

One of the largest changes this year is the partnership between Wiley and the American Geophysical Union, whose portfolio of influential geoscience and geophysics titles is responsible for 6% of citations to journals published by Wiley in the 2012
'/>"/>

Contact: Jennifer Beal
sciencenewsroom@wiley.com
44-012-437-70633
Wiley
Source:Eurekalert

Page: 1 2 3 4 5 6

Related biology news :

1. 2013 Wiley Prize to be awarded at Apr. 5 event
2. The Scandinavian Plant Physiology Society and Wiley extend over 60 years of partnership
3. 66 titles join Wileys journal portfolio in 2013
4. Over 12,000 Wiley Online Books made available in developing countries via Research4Life
5. Wiley makes scientific PDFs interactive with the ReadCube Web Reader from Labtiva
6. 12th annual Wiley Prize in Biomedical Sciences awarded
7. Wiley Prize in Biomedical Sciences awarded to Rosbash, Hall and Young
8. Physiological societies partner with Wiley on new open access journal
9. Wiley Partners with TED
10. British Ecological Society partners with Wiley open access journal Ecology and Evolution
11. Wiley signs collaboration agreement with the Asian Federation of Biotechnology
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/22/2015)... CT , May 22, 2015  NXT-ID, Inc. (NASDAQ: ... June 1st, it will be ending its promotional pricing and ... . Laurence Savin , Head of Marketing ... exclusive promotional pricing until the end of May. To get ... wocketwallet.com/invite and when we open the store on June 1, ...
(Date:5/22/2015)... , May 22, 2015 According ... by Solution (2D, 3D, Thermal, Emotion, Forensic), by Software (Middleware, ... (Government and Utilities, Consumer and Home) - Global Forecast ... grow from $2.77 Billion in 2015 to $6.19 Billion ... Browse 79 market data Tables and   43 ...
(Date:5/21/2015)... According to a new ... Software, Services), by Applications (Surveillance (Airborne, Maritime, Land), ... (Military & Defense & Commercial) - Global Forecast ... is expected to grow from $7252.0 Million in ... Compound Annual Growth Rate (CAGR) of 6.6%. ...
Breaking Biology News(10 mins):NXT-ID, Inc Announces Retail Price For Wocket Smart Wallet And Extends Discounted Promotional Price Till End Of May 2NXT-ID, Inc Announces Retail Price For Wocket Smart Wallet And Extends Discounted Promotional Price Till End Of May 3Facial Recognition Market Worth $6.19 Billion by 2020 2Facial Recognition Market Worth $6.19 Billion by 2020 3Thermal Imaging Market Worth $9,998.9 Million by 2020 2Thermal Imaging Market Worth $9,998.9 Million by 2020 3Thermal Imaging Market Worth $9,998.9 Million by 2020 4
... and swift, viruses are hard to capture on video. Now ... a virus-like particle as it tries to break into and ... learn more about how to deliver drugs via nanoparticles ... well as how to prevent viral infection from occurring. ...
... a busy airport where cold viruses and other germs circulate ... bees and butterflies can pick up fungal, bacterial or viral ... as debilitating as influenza. But "almost nothing is ... postdoctoral researcher Scott McArt and Professor Lynn Adler at the ...
... Rett Syndrome Foundation (IRSF) announces today ten (10) new ... Translational Research Program; and additional funding for current human ... 2013 covers the spectrum of Rett syndrome research, from ... way to treating the girls diagnosed with Rett syndrome. ...
Cached Biology News:Now in 3-D: Video of virus-sized particle trying to enter cell 2Now in 3-D: Video of virus-sized particle trying to enter cell 3As hubs for bees and pollinators, flowers may be crucial in disease transmission 2IRSF announces 2013 awards and implements new Translational Program 2IRSF announces 2013 awards and implements new Translational Program 3
(Date:5/22/2015)... May 22, 2015  Actavis plc (NYSE: ACT ... Court of Appeals for the Second Circuit has issued ... requiring the Company to continue distribution of NAMENDA ® ... http://photos.prnewswire.com/prnh/20130124/NY47381LOGO   "While we are ... we intend to continue our strong efforts to convey ...
(Date:5/22/2015)... , May 22, 2015 According ... Product (1D & 2D Gel Electrophoresis, Agarose & Polyacrylamide ... Reagents, Informatics), by Application & by End User - ... Market is expected to reach around $1.98 Billion by ... period 2015 to 2020. Browse 226 ...
(Date:5/22/2015)... Charm Sciences, Inc. is pleased to ... Grain Inspection, Packers and Stockyards Administration (GIPSA) has ... to monitor aflatoxin in grains utilizing Charm’s ROSA ... Aflatoxin Quantitative Test (solvent-based). , The Charm ... Extraction Technology to extract aflatoxin from the sample ...
(Date:5/22/2015)... 2015 Knowledgent , the data ... explores the potential of big data analytics in the ... developed to help life sciences and healthcare organizations understand ... gain critical business insights. , The life sciences and ... driven by patient profiling, compliance and regulatory requirements, and ...
Breaking Biology Technology:Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 2Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 3Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 4Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 5Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 6Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 7Actavis Confirms Appeals Court Ruling Requiring Continued Distribution of NAMENDA IR 8Electrophoresis Market Worth $1.98 Billion by 2020 2Electrophoresis Market Worth $1.98 Billion by 2020 3Electrophoresis Market Worth $1.98 Billion by 2020 4USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2New White Paper Explores the Potential of Big Data Analytics in Life Sciences and Healthcare 2
... Whitewater, Wis. - The University of Wisconsin-Whitewater has ... what is now known as the Information Technology Infrastructure ... Computer End-User Technologies program, is a product of joint ... will begin this fall semester. It places a far ...
... Metavante Corp., the financial technology subsidiary of Marshall ... June, of Wayne, Pa.-based GHR Systems, Inc. , ... mortgage and consumer finance industries that offers point-of-sale products ... Systems will become a Metavante subsidiary. , ,GHR's client ...
... - Southern Wisconsin's biotech infrastructure has prompted a ... an operating facility that could employ approximately 200 people. ... the southern tier of Wisconsin to manufacture systems used ... CEO Dan Miller. It's a product that company representatives ...
Cached Biology Technology:Whitewater upgrades tech degree program 2Whitewater upgrades tech degree program 3Minneapolis company sets sights on southern Wisconsin 2Minneapolis company sets sights on southern Wisconsin 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: