Navigation Links
When cooperation counts
Date:7/30/2014

Everybody knows the shortest distance between two points is a straight line, and now Harvard researchers have evidence that sperm have been taking the familiar axiom to heart.

Though competition among individual sperm is usually thought to be intense, with each racing for the chance to fertilize the egg, Harvard scientists say in some species, sperm form cooperative groups that allow them to take a straighter path to potential fertilization.

A new study, conducted by Heidi Fisher, a post-doctoral student working in the lab of Hopi Hoekstra, Howard Hughes Investigator and Professor of Organismic and Evolutionary Biology and Molecular and Cellular Biology and the Alexander Agassiz Professor of Zoology in the Museum of Comparative Zoology and post-doctoral student Luca Giomi working with L Mahadevan, the Lola England de Valpine Professor of Applied Mathematics, of Organismic and Evolutionary Biology, and of Physics shows that in Peromyscus maniculatus, a species of deer mouse known to be promiscuous sperm clump together to swim in a more linear fashion. The study is described in a July 23 paper in Proceedings of the Royal Society B.

"We generally think that each individual sperm cell swims its little heart out to get to the egg," Hoekstra said. "But it had been discovered that, in at least a handful of organisms, sperm will cooperate and swim as a group."

Exactly why sperm clump together, however, had remained a mystery until now.

"We had some hints that cooperation was enhancing their swimming performance, but what we didn't understand was how it was helping," Fisher said. "With this study, we combined a mathematical model with much finer-scale measurements that looked at groups that ranged from single sperm cells to groups of as many as 30 cells. What we realized was that that while their overall speed wasn't increasing at all, but that the time it took them to go from point A to point B was d
'/>"/>

Contact: Peter Reuell
preuell@fas.harvard.edu
617-496-8070
Harvard University
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Sibling cooperation in earwig families gives clues to early evolution of social behavior
2. What cooperation and conflict in an insects society can teach us about social acceptance
3. Rewards facilitate human cooperation under natural selection
4. Delayed gratification hurts climate change cooperation
5. Leopoldina signs cooperation agreement with the Academy of Science of South Africa
6. Southerners are less trusting, but trust is a factor in environmental cooperation, study shows
7. Study: MicroRNA cooperation mutes breast cancer oncogenes
8. Leopoldina strengthens cooperation with French national academy
9. JRC and US NOAA enhance cooperation on climate, weather, oceans and coasts
10. BGI, University of Helsinki and Wuhan University sign a MOU concerning cooperation on genomics
11. Suburban sprawl accounts for 50 percent of US household carbon footprint
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... BioPlus Specialty Pharmacy ... has an expanded team of Regional Pharmaceutical Care ... prescriber offices in their regions, with specific areas ... a variety of Regional Pharmaceutical Care Liaisons specializing ... hepatitis C help prescribers understand all the new ...
(Date:12/19/2014)... ME (PRWEB) December 18, 2014 Ed ... director of the Center for Excellence in the Neurosciences ... New England, has been selected as a member of ... is the first neuroscientist from Maine to receive this ... nonprofit organization supported entirely by the Dana Foundation. ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)... Mass. , Dec. 18, 2014  Decision Resources ... dental biomaterial market will grow moderately through 2023 ... procedures and growing awareness of dental biomaterials all spur ... markets such as China and ... will bring dental procedures within reach for a larger ...
Breaking Biology Technology:BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 2UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 3Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 2Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: