Navigation Links
University of Tennessee professor wins world's top prize for ecology, environmental science
Date:7/19/2012

meet him at the government palace where he was congratulated by Catalan President Artus Mas.

Simberloff will return to Barcelona in October to receive the award at a ceremony at the Catalan government palace.

Simberloff, who earned his bachelor's and doctoral degrees at Harvard University, came to UT in 1997 from Florida State University to accept the Gore-Hunger Chair founded by former Vice President Al Gore Jr. in honor of his late sister, Nancy Gore Hunger. Simberloff founded and directs the Institute for Biological Invasions, and he is the editor of the new Encyclopedia of Biological Invasions, an 800-page tome that documents invasions worldwide.

Simberloff's work, frequently cited in textbooks, is studied by most undergraduate ecology students.

As a researcher, he is noted for rigorously testing and sometimes discarding his own theories, thereby strengthening the scientific basis for ecology. His early research on insects on small islands in Florida had assessed the theory of island biogeography, which proposed that the number of species found on an undisturbed island was determined by a balance between ongoing immigration and extinction. This research, conducted with Harvard's E.O. Wilson, won the prestigious Mercer Award in 1971. However, in 1976 Simberloff published further research on this system that contradicted this widely accepted theory, showing that most species that disappeared from the island had never really established ongoing populations beyond the first few individuals that arrived there, and that longstanding populations rarely became extinct.

Simberloff was elected as a fellow in the American Academy of Arts and Sciences in 1993.

Past winners of the Margalef Award are Paul Dayton, a marine benthic biologist at Scripps Institution of Oceanography in La Jolla, Calif.; Sir John Lawton, a British scientist who was knighted for his contributions to ecological sciences; Harold Mooney, biology p
'/>"/>

Contact: Amy Blakely
ablakely@utk.edu
865-771-9127
University of Tennessee at Knoxville
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. Carnegie Mellon Universitys Biometrics Center Selected To House New Pedo-Biometrics Research and Identity Automation Lab
2. Wayne State University researchers program targets safer river fishing, anglers health
3. Winemaking goes high-tech at the University of British Columbia
4. University of Miami-led study finds winds played important role in keeping oil away from S. Fla.
5. New York University scientists discover possible treatment to reduce scarring
6. Royal Astronomical Society and Oxford University Press partnership announced
7. Mainz University coordinates new EU project on the origins of human settlement
8. University of Tennessee professor receives funding for clean coal research
9. University of North Texas Health Science Center Advances Forensic Research by Investing in Semiconductor DNA Sequencing Technology
10. IOC recognizes University of Calgary Sports Injury Research Prevention Centre
11. Loss of biodiversity increasingly threatens human well-being: UBC, University of Michigan research
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
University of Tennessee professor wins world's top prize for ecology, environmental science
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/17/2014)... December 16, 2014 The Activated ... 2013, which is why IBISWorld updated its original industry ... to benefit from an intensified focus on environmental policy. ... new emission standards for power plants and a range ... to IBISWorld Industry Analyst Sarah Kahn, “a range of ...
(Date:12/17/2014)... Washington, USA (PRWEB) December 16, 2014 ... Baum, manager at Philipps- Universität Marburg’s Department of ... and photonics, in the newly released SPIE ... “And never be too shy to ask questions.” ... (science, technology, engineering, and mathematics) occupations ranging from ...
(Date:12/17/2014)... December 17, 2014 Ipsen Biopharmaceuticals, ... IPN; ADR: IPSEY), today announced that ... as Somatuline®) was approved by the U.S. Food ... gastroenteropancreatic neuroendocrine tumors (GEP-NETs) in adult patients with ... metastatic disease to improve progression-free survival (PFS). , ...
(Date:12/17/2014)... This report is a professional ... For an overview analysis, the report introduces quartz ... structure, industry overview, policy analysis, and news analysis, ... has witnessed rapid development with key manufacturers increasing ... report mentions quartz tubing upstream raw materials and ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 82020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: