Navigation Links
UH researcher works on plant-based plastics
Date:1/31/2014

? What chemicals are used to grow the crops? How much water is required? Does utilizing a plant-based source reduce the environmental emissions?

To answer such questions, project collaborator Jay Turner, an engineering professor at Washington University in St. Louis, will work with Robertson to develop the full life cycle assessments of the polymers Robertson creates.

Their findings should help polymer researchers identify not only the polymers with the best mechanical properties, but those that make the most sense in terms of sustainability and environmental impact. This will help shape a science and an industry whose day is undoubtedly coming.

"Polymers and plastics are all around us," Robertson said. "The problem we're facing is related to efforts to find alternative energy sources, but we can't use options like solar or wind to solve this issue. Alternative materials' sources will require a new way of thinking about the problem, and we need to start working on this now."


'/>"/>

Contact: Jeannie Kever
jekever@uh.edu
713-743-0778
University of Houston
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Researchers identify 9 steps to save waterways
2. Zebra fish fins help Oregon researchers gain insight into bone regeneration
3. Researchers reverse some lung diseases in mice by coaxing production of healthy cells
4. CU-Boulder researchers sequence worlds first butterfly bacteria, find surprises
5. Dartmouth researchers develop new tool to identify genetic risk factors
6. Dinosaur fossils from China help Penn researchers describe new Titan
7. UA researchers trace bat killers path
8. UF researchers develop blood test for devastating disease of boas and pythons
9. Vilcek Foundation honors renowned neuroscientist and young researchers with creative promise
10. UA researchers find culprit behind skeletal muscle disease
11. Researchers tune in to protein pairs
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: