Navigation Links
U-M researchers land $2M grant to 'cooperate with nature' on growing algae for energy
Date:7/31/2013

ghput screening technologies to "bio-prospect" for microorganisms associated with biochemical or biomedical applications. For the algae project, she is modifying various laboratory techniques so the team can expand the search for multispecies assemblages that exhibit high yields and efficient waste recycling.

By reconfiguring a device her lab originally developed for use with bacteria, Lin should be able to screen more than a million algal species combinations. A $60,000 grant from MCubed, U-M's one-of-a-kind seed grant program, funded a collaboration between Lin and Cardinale that yielded vital preliminary data that was included in the National Science Foundation proposal.

"If, as we propose, it is possible to engineer naturally diverse communities of algae to enhance the efficiency, yield and stability of yields, then the development of multispecies photosynthetic biorefineries would indeed represent a 'win-win' scenario for biodiversity conservation and energy production in the next century," Lin said.

UC-Santa Barbara's Oakley is an evolutionary biologist who analyzes differences in gene expression among species, and the functional differences that result. He will lead the effort to use high-throughput sequencing technologies to quantify every expressed gene in the various algal combinations. That will enable the researchers to determine how the production of biocrude correlates with the expression of any known gene.

The four-year project will culminate in a conceptual design followed by a life-cycle assessment. The conceptual design will examine all aspects of a multispecies algal biorefinery, from algae cultivation to biocrude production. It will determine the size needed for the facility and will estimate the capital and operating costs, which in turn will show the conditions required to make the biorefinery profitable.

The life-cycle assessment will measure the various environmental impacts attributable to all act
'/>"/>

Contact: Jim Erickson
ericksn@umich.edu
734-647-1842
University of Michigan
Source:Eurekalert

Page: 1 2 3 4 5

Related biology news :

1. UT Southwestern researchers identify novel mechanism that helps stomach bug cause illness
2. Researchers uncover cellular mechanisms for attention in the brain
3. Notre Dame researchers develop system that uses a big data approach to personalized healthcare
4. U of M researchers unveil nations first porcine virus rapid detection test
5. Researchers reveal the clearest new pictures of immune cells
6. Researchers describe potential for MERS coronavirus to spread internationally
7. U of M researchers identify new functions for autoimmune disease risk gene
8. Solving DNA puzzles is overwhelming computer systems, researchers warn
9. Antiviral enzyme contributes to several forms of cancer, University of Minnesota researchers say
10. Carnegie Mellon researchers develop artificial cells to study molecular crowding and gene expression
11. Researchers perform DNA computation in living cells
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Fibrocell Science, Inc. (OTC Bulletin Board: FCSC) announced today ... U.S. Food and Drug Administration (FDA) related to the Biologics ... the treatment of moderate to severe nasolabial fold wrinkles in ... Center for Biologics Evaluation and Research (CBER) when the review ...
... , ANNAPOLIS, Md., Dec. 21 PharmAthene, Inc. (NYSE Amex: ... biological and chemical threats, today announced the appointment of Jeffrey ... Board to eight members. , Dr. Runge is a ... in business risk management, homeland security and homeland defense. ...
... , BOTHELL, WA and VANCOUVER, ... OGXI ) announced today that the Company will host a ... 21, 2009. , A live webcast will be available through ... http://ir.oncogenex.com . Alternatively, you may access the live conference ...
Cached Biology Technology:Fibrocell Science, Inc. Receives FDA Complete Response Letter Regarding azficel-T for Wrinkles 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 3OncoGenex Pharmaceuticals to Host Investor Conference Call at 8:30 a.m. ET, December 21, 2009 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: