Navigation Links
Tel Aviv University researchers root out new and efficient crop plants
Date:7/30/2008

by a grant from the Israeli Ministry of Agriculture and Rural Development to Prof. Fromm and Prof. Eshel.

Ideas Planted in Darwin's Time

In the nineteenth century, scientists were already observing that plant roots naturally seek out the wetter regions in soil.

Although the phenomenon is well documented, scientists until recently had no clue as to how the mechanism worked, or how to make it better. New insights from the Tel Aviv University study could lead to plants that are super water seekers, say researchers.


'/>"/>

Contact: George Hunka
ghunka@aftau.org
212-742-9070
American Friends of Tel Aviv University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. A study by the MUHC and McGill University opens a new door to understanding cancer
2. University of Pennsylvania researchers develop formula to gauge risk of disease clusters
3. University of Oregon researcher finds that on waters surface, nitric acid is not so tough
4. Bioengineers at University of Pennsylvania devise nanoscale system to measure cellular forces
5. Binghamton University researchers investigate evolving malaria resistance
6. Antioxidant to retard wrinkles discovered by Hebrew University researcher
7. Society for General Microbiology 161st Meeting, University of Edinburgh
8. Boston University biomedical engineers find chink in bacterias armor
9. KAUST and American University in Cairo to collaborate on research and academic development
10. UNH becomes first university in nation to use landfill gas as primary energy source
11. University of Minnesota study refutes belief that black men have more aggressive prostate cancer
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Tel Aviv University researchers root out new and efficient crop plants
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: