Navigation Links
Team finds an economical way to boost the vitamin A content of maize
Date:1/17/2008

A team of plant geneticists and crop scientists has pioneered an economical approach to the selective breeding of maize that can boost levels of provitamin A, the precursors that are converted to vitamin A upon consumption. This innovation could help to enhance the nutritional status of millions of people in the developing world.

The new method is described this week in the journal Science.

The team includes scientists from Cornell University, the University of Illinois, Boyce Thompson Institute, DuPont Crop Genetics Research, the University of North Carolina, the City University of New York, the International Maize and Wheat Improvement Center and the U.S. Department of Agriculture.

The innovation involves a new approach for selecting the parent stock for breeding maize, and significantly reduces the ambiguity and expense of finding varieties that yield the highest provitamin A content available. As part of this investigation, the researchers have identified a naturally mutated enzyme that enhances the provitamin A content of maize.

Vitamin A deficiency is a leading cause of eye disease and other health disorders in the developing world. Some 40 million children are afflicted with eye disease, and another 250 million suffer with health problems resulting from a lack of dietary vitamin A.

Maize is the dominant subsistence crop in much of Sub-Saharan Africa and the Americas, the researchers write, where between 17 and 30 percent of children under the age of 5 are vitamin A deficient.

Maize also is one of the most genetically diverse food crops on the planet, said Torbert Rocheford, a professor of plant genetics in the department of crop sciences at Illinois and a corresponding author on the paper.

This diversity is tantalizing to those hoping to make use of desirable traits, but it also provides a formidable challenge in trying to understand the genetic basis of those attributes.

One hurdl
'/>"/>

Contact: Diana Yates
diya@uiuc.edu
217-333-5802
University of Illinois at Urbana-Champaign
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Montana State University researcher finds renewed interest in turning algae into fuel
2. Study locates cholesterol genes; finds surprises about good, bad cholesterol
3. U of M research finds disordered eating less common among teen girls who regularly eat family meals
4. Hybridization partially restores vision in cavefish, NYU study finds
5. MIT finds key to avian flu in humans
6. New report finds great potential for Swedish medical technology
7. Threatened bird species finds home at Western
8. Brain-computer link systems on the brink of breakthrough, study finds
9. RAND study finds evidence disease management programs
10. Study finds first-ever genetic animal model of autism
11. New study finds biodiversity conservation secures ecosystem services for people
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Team finds an economical way to boost the vitamin A content of maize
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: