Navigation Links
Study shows new treatment strategy effective for certain lung cancers
Date:3/10/2011

New Orleans, LA LSU oncologist Vince D. Cataldo, MD, is the lead author of a review article reporting two chemotherapy drugs now indicated for second and third-line therapy in patients with advanced non-small-cell lung cancer are remarkably effective in treating a certain subset of these patients. Dr. Cataldo, a Clinical Assistant Professor of Medicine at LSU Health Sciences Center New Orleans School of Medicine, practicing at LSU's Earl K. Long Medical Center and Hematology-Oncology Clinic in Baton Rouge, and his colleagues say these drugs should be considered as a first-line treatment in people who are known to carry an Epidermal Growth Factor Receptor (EGFR) mutation. The paper is published in the March 10, 2011 issue of the New England Journal of Medicine.

The drugs, Erlotinib and Gefitinib, which are in a class of highly-specific small molecule tyrosine kinase inhibitors, work by blocking the activation of EGFR which is involved in cell survival and growth, as well as the development of a nourishing blood supply and metastasis.

"Targeting the genetic mutation contributing to the development of the cancer, this class of drugs produced a response rate that exceeded 70% in these patients," notes Dr. Cataldo.

The drugs, taken by mouth, also had fewer side effects. Unlike traditional cytotoxic agents, Erlotinib and Gefitinib do not typically cause myelosuppression, neuropathy, alopecia, or severe nausea.

Lung cancer, the leading cause of cancer-related death worldwide, accounted for an estimated 157,300 deaths in the United States in 2010. Approximately 85 to 90% of all cases of lung cancer are nonsmall-cell lung cancer (NSCLC) which is also associated with smoking. Advanced-stage NSCLC is currently considered an incurable disease for which standard chemotherapy provides marginal improvement in overall survival at the expense of substantial morbidity and mortality. Furthermore, less than 30% of patients with meta
'/>"/>

Contact: Leslie Capo
lcapo@lsuhsc.edu
504-568-4806
Louisiana State University Health Sciences Center
Source:Eurekalert

Page: 1 2

Related biology news :

1. Study finds usage of, recommendations for supplements common within various physician specialties
2. Study provides explanation for connection between low birth weight and obesity later in life
3. New UF study shows some sharks follow mental map to navigate seas
4. Study shows how plants sort and eliminate genes over millennia
5. MBARI and Monterey Bay National Marine Sanctuary to study effects of shipping containers lost at sea
6. Rensselaer professor utilizing New York state grant to study adult stem cells
7. Study analyzes role of PARP enzyme in eukaryotes
8. Fossil bird study describes ripple effect of extinction in animal kingdom
9. University of Missouri researcher study provides insight into how corn makes hormones
10. Rainwater harvest study finds roofing material affects water quality
11. A study reveals the keys to the locomotion of snails
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: