Navigation Links
Stevens biomedical engineering students fight hypothermia on the battlefield
Date:5/23/2011

A Biomedical Engineering Senior Design team at Stevens Institute of Technology is working with the U.S. Army and New Jersey physicians to develop a new device to combat hypothermia among wounded soldiers.

Team "Heat Wave" is composed of seniors Walter Galvez, Amanda Mendez, Geoffrey Ng, and Dalia Shendi, in addition to Biomedical Engineering graduate student Maia Hadidi. The team's faculty advisor is Dr. Vikki Hazelwood and consulting physician is Dr. Herman Morchel from Hackensack University Medical Center. Additional expert support from industry and military was provided by Jan Skadberg, RN, Colonel Boots Hodges, Stevens Burrows, and Major Jim Fulton.

"Stevens unique Senior Design approach gave students real-world experience developing a practical technology in collaboration with the military," says Dr. Hazelwood. "This is a fantastic project with a life-saving application as well as entrepreneurial potential."

Developing a portable device to re-warm patients suffering from hypothermia has the potential to substantially impact battlefield medicine. Loss of blood after trauma is the number one cause of combat fatalities in the United States armed forces. Hypothermia complications associated with loss of blood are shown to reduce the rate of survival after severe trauma by 22.5%.

"Current methods for fighting hypothermia in combat zones are to use an IV drip and wool blanket," says Geoffrey. "With these means it takes up to 16 hours to increase the core body temperature to a more stable point."

The Heat Wave system uses heated, humidified air delivered through an oxygen mask to capitalize on the patient's respiratory system. Capitalizing on the fact that the entire blood volume passes through the lungs, this heat is rapidly transferred to the blood via convection. Tests of their system show it is more effective than current treatments.

"We can decrease the time needed to resuscitate a hypothermic patient to
'/>"/>

Contact: Christine del Rosario
cdelrosa@stevens.edu
Stevens Institute of Technology
Source:Eurekalert

Page: 1 2

Related biology news :

1. Nanowire research at Stevens makes cover of Applied Physics Letters
2. Prof. Xiaoguang Meng receives honorary master of engineering from Stevens
3. Stevens and TNO to collaborate on maritime security
4. Stevens team wins First Place in ISPE Student Poster Competition
5. First global conference on systems and enterprises at new Stevens location, Washington, DC, Dec. 3-4
6. Stevens to host 2009 N.J. Inventors Hall of Fame Dinner
7. Stevens hosts Green Building: The Bottom Line, April 8
8. Stevens Center for Science Writings presents: Ravens at the Feast, with Bernd Heinrich, April 1
9. Stevens receives $25,000 grant from the Engineering Information Foundation
10. Stevens strengthens Dominican Republics Early Warning System for Inundations
11. Stevens awarded $1M for advanced biofuels research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: