Navigation Links
Research provides new insights into dogs' natural feeding behavior and finds they target a daily dietary intake that is high in fat
Date:10/29/2012

An international team of researchers has shed new light on the natural feeding behaviour of domestic dogs and demonstrated that they will naturally seek a daily dietary intake that is high in fat. The study also showed that some dogs will overeat if given excess food, reinforcing the importance of responsible feeding to help ensure dogs maintain a healthy body weight.

The research was conducted by the WALTHAM Centre for Pet Nutrition the science centre underpinning Mars Petcare brands such as PEDIGREE, NUTRO and ROYAL CANIN. It was undertaken in collaboration with scientists from the University of Sydney (Australia) and the Institute of Natural Sciences at Massey University (New Zealand).

The research involved adult dogs representing five diverse breeds: the papillon, miniature schnauzer, cocker spaniel, Labrador retriever and St. Bernard. In a series of dietary studies, the dogs were offered combinations of wet or dry foods with varying levels of protein, fat and carbohydrate. The dietary nutrient balance selected by the different breeds was then assessed and compared.

The results showed that, when given the choice, dogs consistently regulated their macronutrient intake, i.e. their intake of protein, fat and carbohydrate. Specifically, the dogs selected a macronutrient profile equating to approximately 63% of their daily calorie intake from fat, 30% from protein and 7% from carbohydrate. The findings also showed that some dogs consumed more than twice as many calories as required when offered excess food.

"The finding that domestic dogs will naturally seek a dietary intake that is high in fat and that they will readily overeat if given the opportunity probably reflects the feeding behaviour of their wild ancestors," said lead study author, Adrian Hewson-Hughes from the WALTHAM Centre for Pet Nutrition. "In the wild, dogs and wolves often have irregular access to food and competition is fierce leading them to try and max
'/>"/>

Contact: Dr. Abigail Stevenson
Abigail.Stevenson@effem.com
44-166-441-5400
WALTHAM Centre for Pet Nutrition
Source:Eurekalert

Page: 1 2

Related biology news :

1. Study by UC Santa Barbara researchers suggests that bacteria communicate by touch
2. Research reveals first evidence of hunting by prehistoric Ohioans
3. Diabetes Research Institute develops oxygen-generating biomaterial
4. APS issues new policy requiring identification of sex or gender in reporting scientific research
5. UC Santa Barbara researchers discover genetic link between visual pathways of hydras and humans
6. Study jointly led by UCSB researcher supports theory of extraterrestrial impact
7. U of Alberta researcher steps closer to understand autoimmune diseases
8. Research on flavanols and procyanidins provides new insights into how these phytonutrients may positively impact human health
9. A project to research biological and chemical aspects of microalgae to fuel approach
10. Scripps Research discoveries lead to newly approved drug for infant respiratory distress syndrome
11. Researchers attempt to solve problems of antibiotic resistance and bee deaths in one
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: