Navigation Links
Rare 95 million-year-old flying reptile Aetodactylus halli is new pterosaur genus, species
Date:4/27/2010

lus, changes in tooth size along the jaw follow a similar pattern to those of other ornithocheirids. However, Aetodactylus differs from all other ornithocheirids in that its jaws were thin and delicate, with a maximum thickness not much greater than 1 centimeter, Myers says. But the specimen does compare favorably with Boreopterus, a related pterosaur from the Early Cretaceous of China, in terms of the number of teeth present in the lower jaw, he says.

Myers has estimated the wingspan around roughly 3 meters, or about 9 feet, indicating Aetodactylus would have been a "medium-sized" pterosaur, he says. While it's not known how Aetodactylus died, at the time of death the reptile was flying over the sea and fell into the water, perhaps while fishing, Jacobs says.

Find hints at new diversity of pterosaurs

North American pterosaurs that date from the Cretaceous are all toothless, except for Aetodactylus and Coloborhynchus, Myers says. The thinness of the jaws, the upward angle of the back half of the mandible and the lack of a pronounced expansion of the jaw tips indicate that Aetodactylus is different from other ornithocheirids and represents a new genus and species of pterosaur.

"Discovery of another ornithocheirid species in Texas hints at a diversity of pterosaurs in the Cretaceous of North America that wasn't previously realized," Myers says. "Aetodactylus also represents one of the final occurrences of ornithocheirids prior to the Late Cretaceous transition to pterosaur faunas that were dominated by the edentulous, or toothless, species."

Texas now claims the only two of their kind

Much of Texas was once submerged under the Western Interior Seaway. The massive sea split North America from the Gulf of Mexico to the Arctic Ocean.

On shore, the terrain was flat and flowering plants were already dominating flora communities in this part of North America, according to paleobotanist Bonnie Jacobs, associ
'/>"/>

Contact: Margaret Allen
mallen@mail.smu.edu
214-768-7664
Southern Methodist University
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. New 150 million-year-old crab species discovered
2. 390-million-year-old scorpion fossil -- biggest bug known
3. Scientists melt million-year-old ice in search of ancient microbes
4. 480-million-year-old fossil sheds light on 150-year-old paleontological mystery
5. 65-million-year-old asteroid impact triggered a global hail of carbon beads
6. Scientists find 245 million-year-old burrows of land vertebrates in Antarctica
7. Origin of claws seen in 390-million-year-old fossil
8. Fossil fragments reveal 500-million-year-old monster predator
9. CU-Boulder study shows 53 million-year-old high Arctic mammals wintered in darkness
10. Study pits man v. machine in piecing together 425-million-year-old jigsaw
11. Story of 4.5 million-year-old whale unveiled in Huelva
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Rare 95 million-year-old flying reptile Aetodactylus halli is new pterosaur genus, species
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: