Navigation Links
RV Polarstern launches 28th Antarctic season

Bremerhaven -- On Friday, Oct. 28 2011 the research icebreaker Polarstern sets off on its 28th Antarctic expedition. Over 200 scientists and technicians from research institutions in 14 countries will take part in the five expedition legs. They will examine a wide variety of topics: oceanography and marine chemistry, atmospheric research and the biology of bacteria, tiny algae and animals all the way to crustaceans, fish and whales. Moreover, the Polarstern will supply Neumayer Station III in Antarctica with material, provisions and personnel.

The first leg of the expedition will take the vessel from Bremerhaven to Cape Town. On the way from the temperate latitudes through the subtropics and tropics researchers will investigate the material flows between ocean and atmosphere in the various climate zones. They want to find out more about how, for example, varying air humidity, cloud cover and temperature influence one another and how much radiation energy reaches the Earth's and the ocean surface. The incident radiation energy is the driving force for most physical processes in the Earth's climate system. On this leg, furthermore, technical scientific equipment (hydroacoustic, IT and communication systems, etc.) will be tried out, calibrated and tested. This is a major prerequisite for meeting the high demands placed on the measured data gained in this way.

Whales are a subject of study for the Oceanic Acoustics team at the Alfred Wegener Institute for Polar and Marine Research in the Helmholtz Association. Last year researchers for the first time put out a recorder that records whale songs around 700 kilometres off the coast of Namibia. Since visual observations of whales in the enormous oceans are rare, the bioacoustics experts wish to collect information on which species occur when in areas only presumed to be the mating grounds of blue and fin whales up to now. Since the behaviour-specific calls, such as during mating, are known, the rese

Contact: Folke Mehrtens
Helmholtz Association of German Research Centres

Page: 1 2

Related biology news :

1. Polarstern expedition LOHAFEX can be conducted
2. Research vessel Polarstern starts 24th Arctic season
3. Highlight of the Polarstern expedition
4. Council of Science and Humanities recommends building of Polarstern II
5. Research ship Polarstern returns from Antartica
6. Research vessel Polarstern at North Pole
7. The Rett Syndrome Research Trust launches operations
8. LIAI launches new division to look at novel approaches to heart disease and inflammation
9. Complete Genomics launches, becomes worlds first large-scale human genome sequencing company
10. launches new animated 3-D views of human body in action
11. International Council for Science launches major research program on natural disasters
Post Your Comments:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: