Navigation Links
Pneumonia revealed in a cough
Date:6/27/2013

A new method, which analyzes the sounds in a child's cough, could soon be used in poor, remote regions to diagnose childhood pneumonia reliably. According to Udantha Abeyratne from the University of Queensland in Australia and colleagues, this simple technique of recording coughs with a microphone on the patient's bedside table, has the potential to revolutionize the management of childhood pneumonia in remote regions around the world. Their work is published online in Springer's journal Annals of Biomedical Engineering.

Pneumonia is the leading killer of young children around the world. Since it is largely a disease of poverty, the vast majority of deaths occur in resource-poor regions such as sub-Saharan Africa, South Asia and remote areas of China. The lack of laboratory testing facilities and trained healthcare personnel in these regions mean difficulties in the timely diagnosis and adequate treatment of childhood pneumonia.

At the moment, community workers in these regions use the World Health Organization's simple clinical algorithm to diagnose pneumonia. However there are some limitations, including the high rate of false positive results which lead to over-prescription of rare antibiotic stocks.

Abeyratne and team's work identifies an easy-to-use alternative that addresses these challenges, in the form of new technology which analyzes cough sounds to diagnose pneumonia. Indeed, cough is a main symptom of pneumonia and carries vital information on the lower respiratory tract - consolidation of the lungs and secretions in particular. These markers of infection alter the acoustic properties of coughs helping to identify pneumonia-specific features.

The researchers analyzed 815 cough events recorded from a total of 91 hospitalized children with and without pneumonia, at the Sardjito Hospital of Gadjah Mada University in Indonesia. Cough sounds were collected by microphones placed on nearby bedside tables. Coughs we
'/>"/>

Contact: Sophia Grein
sophia.grein@springer.com
49-622-148-78414
Springer
Source:Eurekalert

Page: 1 2

Related biology news :

1. Ceramic indoor cookstove use did not significantly lower child pneumonia risk in rural Kenya
2. Scientists sequence genome of pathogen responsible for pneumocystis pneumonia
3. Stopping smoking reduces risk of bacterial pneumonia in people with HIV
4. Low vitamin D levels a risk factor for pneumonia
5. Genetic mutation depicted in van Goghs sunflower paintings revealed by scientists
6. Ancient giant turtle fossil revealed
7. Key part of plants rapid response system revealed
8. Detector of DNA damage: Structure of a repair factor revealed
9. Mystery of elephant infrasounds revealed
10. The genetic cause of a severe skeletal disease in Brazilian Terrier puppies revealed
11. Bread wheats large and complex genome is revealed
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: