Navigation Links
Oscar Pistorius: Previously confidential study results released on amputee sprinter
Date:6/29/2009

Dallas, TX (June 29, 2009) -- A team of experts in biomechanics and physiology that conducted experiments on Oscar Pistorius, the South African bilateral amputee track athlete, have just published their findings in the Journal of Applied Physiology. Some of their previously confidential findings were presented to the Court of Arbitration for Sport (CAS) in Lausanne, Switzerland in May of 2008. Other findings are now being released for the first time.

A portion of the team's findings had been presented at the CAS to appeal the eligibility ban that had been imposed on Pistorius by the International Association of Athletics Federations (IAAF) barring him from sanctioned competitions, including the Olympics and World Championships.

The IAAF had claimed that the Cheetah Flex-Foot prostheses (J-shaped, high-performance prostheses used for running) worn by Pistorius give him an advantage over able-bodied runners.

The appeal was successfully presented on behalf of Pistorius by the international law firm of Dewey & LeBoeuf, who took the case on a pro-bono basis. The CAS concluded that the IAAF failed to prove that the biomechanical effects of the Cheetah prostheses give Pistorius an advantage over other athletes not using the prostheses.

The authors of the study are Peter Weyand of Southern Methodist University, Matthew Bundle of the University of Wyoming, Craig McGowan of the University of Texas at Austin, Alena Grabowski and Hugh Herr of the Massachusetts Institute of Technology, Mary Beth Brown of Georgia Institute of Technology and Rodger Kram of the University of Colorado at Boulder. None of the authors received compensation for the research or work on behalf of the CAS hearing. The group agreed to conduct the experiments with the understanding that they would be able to publish their scientific findings after the CAS ruling.

The experiments were conducted at the Locomotion Laboratory of Rice University in H
'/>"/>

Contact: Kim Cobb
cobbk@smu.edu
214-768-7654
Southern Methodist University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. UTMB researchers to be honored at Oscars of invention
2. Baiji Dolphin previously thought extinct spotted in the Yangtze River
3. Pathogens use previously undescribed mechanism to sabotage host immune system
4. Bacterial infections in premature babies more common than previously realized
5. Galiximab in combination with rituximab in patients with previously untreated follicular lymphoma
6. Species have come and gone at different rates than previously believed
7. Setting the record right: species diversity less dramatic than previously believed
8. Potent greenhouse gas more prevalent in atmosphere than previously assumed
9. Nanoparticles in the home: More and smaller than previously detected
10. Whispering bats are 100 times louder than previously thought
11. Nations that sow food crops for biofuels may reap less than previously thought
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Oscar Pistorius: Previously confidential study results released on amputee sprinter
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: