Navigation Links
Old stain in a new combination
Date:5/20/2009

etocytes and thus improve the control of malaria," states Professor Dr. Olaf Mller, Project Head in the Department of Tropical Medicine and Public Health of the Hygiene Institute at the University of Heidelberg.

Methylene blue prevents transmission to mosquitoes

The appropriate component for such an alternative is a proven agent the methylene blue stain which has been given to malaria patients since the end of the 19th century has proven to be safe, well tolerated, and effective in combination with various malaria medications.

In the current study in Burkina Faso with 160 malaria patients between the ages of six and ten the Heidelberg scientists tested the effect of combination therapies with artemisinins and methylene blue on gametocytes in the blood. One group of the children received the standard treatment, consisting of a combination of artesunate and amodiaquine. Two other groups received methylene blue combined with one of the two drugs respectively. The physicians checked the number of gametocytes in blood samples three, seven, and fourteen days after the start of therapy.

Combination therapy is twice as effective as standard therapy

It was shown that both combination therapies are twice as effective against gametocytes as the standard therapy these parasites had almost completely disappeared in the first few days. "Methylene blue not only inhibits the formation of the reproductive forms, but also destroys already existing cells," explains Professor Mller. "In this way, the profiles of methylene blue and artemisinins, which quickly and effectively eliminate the parasites in the red blood cells, complement each other." Since the study group from Heidelberg has used methylene blue in Western Africa for years, it has already been adequately clinically tested severe or frequent side effects did not occur. Especially important is that the combination makes it more difficult for resistance to artemisi
'/>"/>

Contact: Prof. Olaf Mueller
Olaf.mueller@urz.uni-heidelberg.de
49-062-215-65035
University Hospital Heidelberg
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Grasslands: The future of sustainable agriculture
2. Going bananas for sustainable research -- scientists create fuel from African crop waste
3. K-State biologist collaborating with researchers in Africa on grassland sustainability, biodiversity
4. Organizational Change Management for Sustainability: The Harvard Case Study
5. Biofuels can provide viable, sustainable solution to reducing petroleum dependence
6. Symposium at UH will address how to put sustainability into practice
7. Biggest ever public investment in bioenergy to help provide clean, green and sustainable fuels
8. TXOTX, coordinated international project to contribute to sustainability of the marine resources
9. Abundance of ladybugs in olive orchards is an indicator of health and sustainability
10. Next generation microscopy: No stain, big gain
11. New publishing partnership for Energy for Sustainable Development
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance ... technology to industry leaders such as Intel, Jabra, Atlas, ... biometric wearable products. These products will be showcased at ... Las Vegas . "Our partners ... and robust – with the clinical data to back ...
(Date:12/11/2014)... --Research and Markets , ... ) has announced the addition of the ... their offering. One major trend ... multimodal biometric systems. Multimodal biometric systems utilize more ... and identification purposes. This helps to reduce the ...
(Date:12/10/2014)... , Dec. 9, 2014  Wake Forest Baptist Medical ... building for its School of Medicine. Funding for this ... capital campaign that will be publicly launched next summer. ... located in the former 60 series R.J. Reynolds Tobacco ... Quarter. Construction will begin immediately with plans to be ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4
... conducted by researchers at The University of Texas School ... abuse and dependence among Hispanic male populations in the ... along the U.S.-Mexico border. The expansion is supported ... on Alcohol Abuse and Alcoholism of the National Institutes ...
... book Artificial Gravity , edited by Gilles Clment and ... from the International Academy of Astronautics. This award is given ... the Academy in the fields related to life science. The ... on 28 September 2008 in Glasgow, Scotland. Artificial ...
... 2008) Just three years after it was discovered, a ... the Wildlife Conservation Society, which recently published the first-ever census ... the large, forest-dwelling primate hovers at 1,117 individuals, according to ... Oryx . The population estimate was the ...
Cached Biology News:Survey of Hispanics and alcohol dependence 2
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... , , , , , , ... , 1Thermo Finnigan, Piscataway, NJ; , ... , Chemical Structure Validation , ... of ion trap mass spectrometers , , ...
... , , , , , , David Barnidge ... , Neuromics, Inc., Minneapolis, MN , ... , ICAT Analysis , , , ... ProteomeX integrated proteomics workstation., , , , , , ...
... , , , , , ... Center for Neurologic Diseases, Brigham and Womens Hospital, Harvard , ... , , , Genetic manipulations using neuronal cells ... RNA (siRNA) , to primary neuronal cultures is of critical ...
Cached Biology Technology:Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 2Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 3Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 4Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 5Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 6Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 7Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 8Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 9Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 2Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 3Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 4Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 5Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 6Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 7Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 2Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 3Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 4Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 5
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: